Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17029 KHDC3L C6orf221;ECAT1 Homo sapiens No

HuProt v2.0
Block Row Column Clone
26 26 5 JHU17029
26 26 6 JHU17029
HuProt v3.0
Block Row Column Clone
23 1 23 JHU17029
23 2 23 JHU17029
HuProt v3.1
Block Row Column Clone
23 1 23 JHU17029
23 2 23 JHU17029

External Database ID

Nucleotide (651bp)

>JHU17029
ATGGACGCTCCCAGGCGGTTTCCGACGCTCGTGCAACTGATGCAGCCAAAAGCAATGCCAGTGGAGGTGCTCGGTCACCT
CCCTAAGCGGTTCTCCTGGTTCCACTCTGAGTTCCTGAAGAATCCGAAGGTAGTTCGCCTTGAGGTTTGGCTGGTGGAAA
AGATCTTCGGCCGGGGCGGAGAACGCATCCCGCACGTCCAGGGTATGTCCCAAATCTTGATTCACGTGAATCGATTGGAC
CCTAACGGCGAGGCTGAGATCTTGGTATTTGGGAGGCCTTCTTACCAGGAGGACACAATCAAGATGATCATGAACCTGGC
TGACTATCACCGCCAGCTCCAGGCGAAAGGCTCAGGAAAGGCCCTCGCCCAGGATGTCGCCACTCAGAAGGCCGAGACCC
AGCGGTCTTCAATAGAAGTCCGGGAGGCCGGGACGCAGCGTTCGGTGGAGGTCCGGGAGGCCGGGACCCAGCGTTCGGTG
GAAGTCCAGGAGGTCGGGACACAGGGTTCTCCGGTGGAGGTGCAGGAGGCCGGGACCCAGCAGTCTCTCCAGGCTGCCAA
CAAGTCGGGGACCCAGCGATCCCCCGAAGCTGCCAGCAAGGCAGTGACCCAGCGGTTTCGCGAGGATGCCCGGGACCCAG
TTACTAGATTA

Protein (217aa)

>JHU17029
MDAPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGGERIPHVQGMSQILIHVNRLD
PNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGKALAQDVATQKAETQRSSIEVREAGTQRSVEVREAGTQRSV
EVQEVGTQGSPVEVQEAGTQQSLQAANKSGTQRSPEAASKAVTQRFREDARDPVTRL