Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU17026 TLDC2 Homo sapiens No

HuProt v2.0
Block Row Column Clone
10 26 5 JHU17026
10 26 6 JHU17026
HuProt v3.0
Block Row Column Clone
23 1 15 JHU17026
23 2 15 JHU17026
HuProt v3.1
Block Row Column Clone
23 1 15 JHU17026
23 2 15 JHU17026

External Database ID

Nucleotide (645bp)

>JHU17026
ATGAGAGGCCTCCGCTGGCGTTACACTCGGCTGCCCAGCCAGGTGGAGGACACCCTGTCTGGGGAGGAGGGTAACGAAGA
GGAAGAGGAGGAGGAGGCAGCTCCAGACCCAGCTGCTGCTCCTGAGGATCCCACGGTGCCCCAGCTGACAGAAGCCAGCC
AGGTTTTGAGTGCCTCAGAGATTCGGCAGCTCAGCTTTCACTTCCCACCAAGAGTCACCGGCCATCCCTGGAGTCTGGTC
TTCTGCACGTCAAGGGACGGTTTCAGCCTGCAGAGCCTGTACCGGCGGATGGAGGGCTGCAGCGGGCCAGTGCTGCTGGT
GCTCAGGGACCAGGACGGGCAGATATTTGGAGCCTTCTCCTCCTCGGCTATCCGACTCAGCAAAGGCTTCTATGGTACTG
GCGAGACATTCCTCTTCTCCTTCTCCCCACAGCTGAAGGTCTTTAAGTGGACTGGAAGCAACTCTTTCTTTGTGAAGGGA
GACTTGGATTCACTGATGATGGGCAGTGGCAGTGGCCGGTTTGGGCTGTGGTTGGATGGAGACTTGTTCCGCGGGGGAAG
CTCCCCTTGCCCGACCTTCAACAACGAGGTGCTGGCCCGGCAGGAGCAGTTCTGCATCCAGGAGCTGGAGGCTTGGCTTC
TCAGC

Protein (215aa)

>JHU17026
MRGLRWRYTRLPSQVEDTLSGEEGNEEEEEEEAAPDPAAAPEDPTVPQLTEASQVLSASEIRQLSFHFPPRVTGHPWSLV
FCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKG
DLDSLMMGSGSGRFGLWLDGDLFRGGSSPCPTFNNEVLARQEQFCIQELEAWLLS