Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00017 CKB CKBB Homo sapiens Yes Kinases; Metabolism; Signal Transduction

HuProt v2.0
Block Row Column Clone
20 1 9 JHU00017
20 1 10 JHU00017
HuProt v3.0
Block Row Column Clone
2 1 20 JHU00017
2 2 20 JHU00017
HuProt v3.1
Block Row Column Clone
2 1 20 JHU00017
2 2 20 JHU00017

External Database ID

Nucleotide (1146bp)

>JHU00017
ATGCCCTTCTCCAACAGCCACAACGCACTGAAGCTGCGCTTCCCGGCCGAGGACGAGTTCCCCGACCTGAGCGCCCACAA
CAACCACATGGCCAAGGTGCTGACCCCCGAGCTGTACGCGGAGCTGCGCGCCAAGAGCACGCCGAGCGGCTTCACGCTGG
ACGACGTCATCCAGACAGGCGTGGACAACCCGGGCCACCCGTACATCATGACCGTGGGCTGCGTGGCGGGCGACGAGGAG
TCCTACGAAGTGTTCAAGGATCTCTTCGACCCCATCATCGAGGACAGGCACGGCGGCTACAAGCCCAGCGATGAGCACAA
GACCGACCTCAACCCCGACAACCTGCAGGGCGGCGACGACCTGGACCCCAACTACGTGCTGAGCTCGCGGGTGCGCACGG
GCCGCAGCATCCGTGGCTTCTGCCTCCCCCCGCACTGCAGCCGCGGGGAGCGCCGAGCCATCGAGAAGCTCGCGGTGGAA
GCCCTGTCCAGCCTGGACGGCGACCTGGCGGGCCGATACTACGCGCTCAAGAGCATGACGGAGGCGGAGCAGCAGCAGCT
CATCGACGACCACTTCCTCTTCGACAAGCCCGTGTCGCCCCTGCTGCTGGCCTCGGGCATGGCCCGCGACTGGCCCGACG
CCCGCGGTATCTGGCACAATGACAATAAGACCTTCCTGGTGTGGGTCAACGAGGAGGACCACCTGCGGGTCATCTCCATG
CAGAAGGGGGGCAACATGAAGGAGGTGTTCACCCGCTTCTGCACCGGCCTCACCCAGATTGAAACTCTCTTCAAGTCTAA
GGACTATGAGTTCATGTGGAACCCTCACCTGGGCTACATCCTCACCTGCCCATCCAACCTGGGCACCGGGCTGCGGGCAG
GTGTGCATATCAAGCTGCCCAACCTGGGCAAGCATGAGAAGTTCTCGGAGGTGCTTAAGCGGCTGCGACTTCAGAAGCGA
GGCACAGGCGGTGTGGACACGGCTGCGGTGGGCGGGGTCTTCGACGTCTCCAACGCTGACCGCCTGGGCTTCTCAGAGGT
GGAGCTGGTGCAGATGGTGGTGGACGGAGTGAAGCTGCTCATCGAGATGGAACAGCGGCTGGAGCAGGGCCAGGCCATCG
ACGACCTCATGCCTGCCCAGAAATAG

Protein (381aa)

>JHU00017
MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEE
SYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVE
ALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
QKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKR
GTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK