Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00168 HACD1 PTPLA Homo sapiens Yes Metabolism

HuProt v2.0
Block Row Column Clone
40 1 7 JHU00168
40 1 8 JHU00168
HuProt v3.0
Block Row Column Clone
3 5 22 JHU00168
3 6 22 JHU00168
HuProt v3.1
Block Row Column Clone
3 5 22 JHU00168
3 6 22 JHU00168

External Database ID

Nucleotide (867bp)

>JHU00168
ATGGGGCGCCTGACGGAAGCGGCGGCAGCGGGCAGCGGCTCTCGGGCTGCAGGCTGGGCAGGGTCCCCTCCCACGCTCCT
GCCGCTGTCTCCCACGTCCCCCAGGTGCGCGGCCACCATGGCGTCCAGCGACGAGGACGGCACCAACGGCGGCGCCTCGG
AGGCCGGCGAGGACCGGGAGGCTCCCGGCAAGCGGAGGCGCCTGGGGTTCTTGGCCACCGCCTGGCTCACCTTCTACGAC
ATCGCCATGACCGCGGGGTGGTTGGTTCTAGCTATTGCCATGGTACGTTTTTATATGGAAAAAGGAACACACAGAGGTTT
ATATAAAAGTATTCAGAAGACACTTAAATTTTTCCAGACATTTGCCTTGCTTGAGATAGTTCACTGTTTAATTGGAATTG
TACCTACTTCTGTGATTGTGACTGGGGTCCAAGTGAGTTCAAGAATCTTTATGGTGTGGCTCATTACTCACAGTATAAAA
CCAATCCAGAATGAAGAGAGTGTGGTGCTTTTTCTGGTCGCGTGGACTGTGACAGAGATCACTCGCTATTCCTTCTACAC
ATTCAGCCTTCTTGACCACTTGCCATACTTCATTAAATGGGCCAGATATAATTTTTTTATCATCTTATATCCTGTTGGAG
TTGCTGGTGAACTTCTTACAATATACGCTGCCTTGCCGCATGTGAAGAAAACAGGAATGTTTTCAATAAGACTTCCTAAC
AAATACAATGTCTCTTTTGACTACTATTATTTTCTTCTTATAACCATGGCATCATATATACCTTTGTTTCCACAACTCTA
TTTTCATATGTTACGTCAAAGAAGAAAGGTGCTTCATGGAGAGGTGATTGTAGAAAAGGATGATTAG

Protein (288aa)

>JHU00168
MGRLTEAAAAGSGSRAAGWAGSPPTLLPLSPTSPRCAATMASSDEDGTNGGASEAGEDREAPGKRRRLGFLATAWLTFYD
IAMTAGWLVLAIAMVRFYMEKGTHRGLYKSIQKTLKFFQTFALLEIVHCLIGIVPTSVIVTGVQVSSRIFMVWLITHSIK
PIQNEESVVLFLVAWTVTEITRYSFYTFSLLDHLPYFIKWARYNFFIILYPVGVAGELLTIYAALPHVKKTGMFSIRLPN
KYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVLHGEVIVEKDD