Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00164 PPP3CC CALNA3;CNA3 Homo sapiens Yes Cell Death

HuProt v2.0
Block Row Column Clone
32 1 7 JHU00164
32 1 8 JHU00164
HuProt v3.0
Block Row Column Clone
3 5 14 JHU00164
3 6 14 JHU00164
HuProt v3.1
Block Row Column Clone
3 5 14 JHU00164
3 6 14 JHU00164

External Database ID

Nucleotide (1539bp)

>JHU00164
ATGTCCGGGAGGCGCTTCCACCTCTCCACCACCGACCGCGTCATCAAAGCTGTCCCCTTTCCTCCAACCCAACGGCTTAC
TTTCAAGGAAGTATTTGAGAATGGGAAACCTAAAGTTGATGTTTTAAAAAACCATTTGGTAAAGGAAGGACGACTGGAAG
AGGAAGTAGCCTTAAAGATAATCAATGATGGGGCTGCCATCCTGAGGCAAGAGAAGACTATGATAGAAGTAGATGCTCCA
ATCACAGTATGTGGTGATATTCATGGACAATTCTTTGACCTAATGAAGTTATTTGAAGTTGGAGGATCACCTAGTAACAC
ACGCTACCTCTTTCTGGGTGACTATGTGGACAGAGGCTATTTCAGTATAGAGTGTGTGCTGTATTTATGGAGTTTAAAGA
TTAATCATCCCAAAACATTGTTTCTGCTTCGGGGAAATCATGAATGCAGGCATCTTACAGACTATTTCACCTTCAAACAG
GAATGTCGAATCAAATATTCGGAACAGGTGTATGATGCCTGTATGGAGACATTTGACTGTCTTCCTCTTGCTGCCCTCTT
AAACCAGCAGTTTCTCTGTGTACATGGAGGAATGTCACCTGAAATTACTTCTTTAGATGACATTAGGAAATTAGACAGGT
TTACGGAACCTCCCGCCTTTGGACCTGTGTGTGACCTGCTTTGGTCTGATCCCTCAGAGGATTATGGCAATGAGAAGACC
TTGGAGCACTATACCCACAACACTGTCCGAGGGTGCTCTTATTTCTACAGTTACCCTGCAGTTTGTGAATTTTTGCAGAA
CAATAATTTACTATCAATTATCAGAGCCCATGAAGCCCAAGATGCTGGGTATCGAATGTACAGGAAGAGCCAAGCCACAG
GCTTTCCATCACTTATTACAATTTTCTCTGCCCCCAATTACCTAGATGTCTATAACAATAAAGCTGCTGTGTTGAAATAT
GAAAACAATGTCATGAATATCAGGCAGTTTAACTGTTCTCCACACCCCTACTGGCTTCCAAACTTTATGGATGTTTTCAC
ATGGTCTTTGCCTTTTGTTGGGGAAAAAGTCACAGAGATGCTGGTAAATGTGCTCAACATATGCTCTGATGACGAACTGA
TTTCTGATGATGAAGCAGAAGGAAGCACTACAGTTCGTAAGGAGATCATCAGGAATAAGATCAGAGCCATTGGGAAGATG
GCACGGGTCTTTTCAATTCTTCGGCAAGAAAGTGAGAGTGTGCTGACTCTCAAGGGCCTGACTCCCACAGGCACACTCCC
TCTGGGCGTCCTCTCAGGAGGCAAGCAGACTATCGAGACAGCCACAGTAGAAGCGGTAGAGGCCCGGGAAGCCATCAGAG
GGTTCTCGCTTCAGCACAAGATCCGGAGTTTTGAAGAAGCGCGAGGTCTGGACCGAATTAATGAGCGAATGCCACCCCGA
AAGGATAGCATACACGCTGGTGGGCCAATGAAATCTGTAACCTCAGCACACTCACATGCTGCGCACAGGAGCGACCAAGG
GAAGAAAGCCCATTCATAG

Protein (512aa)

>JHU00164
MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQEKTMIEVDAP
ITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTLFLLRGNHECRHLTDYFTFKQ
ECRIKYSEQVYDACMETFDCLPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAVLKY
ENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKM
ARVFSILRQESESVLTLKGLTPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPR
KDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS