Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00016 CDKN2D Homo sapiens Yes Cell Death; Kinases; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
18 1 5 JHU00016
18 1 6 JHU00016
HuProt v3.0
Block Row Column Clone
3 1 3 JHU00016
3 2 3 JHU00016
HuProt v3.1
Block Row Column Clone
3 1 3 JHU00016
3 2 3 JHU00016

External Database ID

Nucleotide (501bp)

>JHU00016
ATGCTGCTGGAGGAGGTTCGCGCCGGCGACCGGCTGAGTGGGGCGGCGGCCCGGGGCGACGTGCAGGAGGTGCGCCGCCT
TCTGCACCGCGAGCTGGTGCATCCCGACGCCCTCAACCGCTTCGGCAAGACGGCGCTGCAGGTCATGATGTTTGGCAGCA
CCGCCATCGCCCTGGAGCTGCTGAAGCAAGGTGCCAGCCCCAATGTCCAGGACACCTCCGGTACCAGTCCAGTCCATGAC
GCAGCCCGCACTGGATTCCTGGACACCCTGAAGGTCCTAGTGGAGCACGGGGCTGATGTCAACGTGCCTGATGGCACCGG
GGCACTTCCAATCCATCTGGCAGTTCAAGAGGGTCACACTGCTGTGGTCAGCTTTCTGGCAGCTGAATCTGATCTCCATC
GCAGGGACGCCAGGGGTCTCACACCCTTGGAGCTGGCACTGCAGAGAGGGGCTCAGGACCTCGTGGACATCCTGCAGGGC
CACATGGTGGCCCCGCTGTAG

Protein (166aa)

>JHU00016
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHD
AARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQG
HMVAPL