Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00158 PPP1R3C PPP1R5 Homo sapiens Yes Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
46 1 7 JHU00158
46 1 8 JHU00158
7 24 31 JHU00158
7 24 32 JHU00158
HuProt v3.0
Block Row Column Clone
3 5 27 JHU00158
3 6 27 JHU00158
17 45 18 JHU00158
17 46 18 JHU00158
HuProt v3.1
Block Row Column Clone
3 5 27 JHU00158
3 6 27 JHU00158
17 45 18 JHU00158
17 46 18 JHU00158

External Database ID

Nucleotide (954bp)

>JHU00158
ATGAGCTGCACCAGAATGATCCAGGTTTTAGATCCACGTCCTTTGACAAGTTCGGTCATGCCCGTGGATGTGGCCATGAG
GCTTTGCTTGGCACATTCACCACCTGTGAAGAGTTTCCTGGGCCCGTACGATGAATTTCAACGACGACATTTTGTGAATA
AATTAAAGCCCCTGAAATCATGTCTCAATATAAAACACAAAGCCAAATCACAGAATGACTGGAAGTGCTCACACAACCAA
GCCAAGAAGCGCGTTGTGTTTGCTGACTCCAAGGGCCTCTCTCTCACTGCGATCCATGTCTTCTCCGACCTCCCAGAAGA
ACCAGCGTGGGATCTGCAGTTTGATCTCTTGGACCTTAATGATATCTCCTCTGCCTTAAAACACCACGAGGAGAAAAACT
TGATTTTAGATTTCCCTCAGCCTTCAACCGATTACTTAAGTTTCCGGAGCCACTTTCAGAAGAACTTTGTCTGTCTGGAG
AACTGCTCATTGCAAGAGCGAACAGTGACAGGGACTGTTAAAGTCAAAAATGTGAGTTTTGAGAAGAAAGTTCAGATCCG
TATCACTTTCGATTCTTGGAAAAACTACACTGACGTAGACTGTGTCTATATGAAAAATGTGTATGGTGGCACAGATAGTG
ATACCTTCTCATTTGCCATTGACTTACCCCCTGTCATTCCAACTGAGCAGAAAATTGAGTTCTGCATTTCTTACCATGCT
AATGGGCAAGTCTTTTGGGACAACAATGATGGTCAGAATTATAGAATTGTTCATGTTCAATGGAAGCCTGATGGGGTGCA
GACACAGATGGCACCCCAGGACTGTGCATTCCACCAGACGTCTCCTAAGACAGAGTTAGAGTCAACAATCTTTGGCAGTC
CGAGGCTGGCTAGTGGGCTCTTCCCAGAGTGGCAGAGCTGGGGGAGAATGGAGAACTTGGCCTCTTATCGATAG

Protein (317aa)

>JHU00158
MSCTRMIQVLDPRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQ
AKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSALKHHEEKNLILDFPQPSTDYLSFRSHFQKNFVCLE
NCSLQERTVTGTVKVKNVSFEKKVQIRITFDSWKNYTDVDCVYMKNVYGGTDSDTFSFAIDLPPVIPTEQKIEFCISYHA
NGQVFWDNNDGQNYRIVHVQWKPDGVQTQMAPQDCAFHQTSPKTELESTIFGSPRLASGLFPEWQSWGRMENLASYR