Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00155 PPME1 PME1 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
30 1 7 JHU00155
30 1 8 JHU00155
HuProt v3.0
Block Row Column Clone
3 5 29 JHU00155
3 6 29 JHU00155
HuProt v3.1
Block Row Column Clone
3 5 29 JHU00155
3 6 29 JHU00155

External Database ID

Nucleotide (1161bp)

>JHU00155
ATGTCGGCCCTCGAAAAGAGCATGCACCTCGGCCGCCTTCCCTCTCGCCCACCTCTACCCGGCAGCGGGGGCAGTCAGAG
CGGAGCCAAGATGCGAATGGGCCCTGGAAGAAAGCGGGACTTTTCCCCTGTTCCTTGGAGTCAGTATTTTGAGTCCATGG
AAGATGTAGAAGTAGAGAATGAAACTGGCAAGGATACTTTTCGAGTCTACAAGAGTGGTTCAGAGGGTCCAGTCCTGCTC
CTTCTGCATGGAGGAGGTCATTCTGCCCTTTCTTGGGCTGTGTTCACGGCAGCGATTATTAGTAGAGTTCAGTGTAGGAT
TGTAGCTTTGGATCTGCGAAGTCATGGTGAAACAAAGGTCAAGAATCCTGAAGATCTGTCTGCAGAAACAATGGCAAAAG
ACGTTGGCAATGTGGTTGAAGCCATGTATGGGGACCTTCCTCCTCCAATTATGCTGATTGGACATAGCATGGGTGGTGCT
ATTGCAGTCCACACAGCATCATCCAACCTGGTACCAAGCCTCTTGGGTCTGTGCATGATTGATGTTGTAGAAGGTACAGC
TATGGATGCACTTAATAGCATGCAGAATTTCTTACGGGGTCGTCCTAAAACCTTCAAGTCTCTGGAGAATGCTATTGAAT
GGAGTGTGAAGAGTGGCCAGATTCGAAATCTGGAGTCTGCCCGTGTCTCAATGGTTGGCCAAGTCAAACAGTGTGAAGGA
ATTACAAGTCCAGAAGGCTCAAAATCTATAGTGGAAGGAATCATAGAGGAAGAAGAAGAAGATGAGGAAGGAAGTGAGTC
TATAAGCAAGAGGAAAAAGGAAGATGACATGGAGACCAAGAAAGACCATCCATACACCTGGAGAATTGAACTGGCAAAAA
CAGAAAAATACTGGGACGGCTGGTTCCGAGGCTTATCCAATCTCTTTCTTAGTTGTCCCATTCCTAAATTGCTGCTCTTG
GCTGGTGTTGATAGATTGGATAAAGATCTGACCATTGGCCAGATGCAAGGGAAGTTCCAGATGCAGGTCCTACCCCAGTG
TGGCCATGCAGTCCATGAGGATGCCCCTGACAAGGTAGCTGAAGCTGTTGCCACTTTCCTGATCCGGCACAGGTTTGCAG
AACCCATCGGTGGATTCCAGTGTGTGTTTCCTGGCTGTTAG

Protein (386aa)

>JHU00155
MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLL
LLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHSMGGA
IAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCEG
ITSPEGSKSIVEGIIEEEEEDEEGSESISKRKKEDDMETKKDHPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLL
AGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVAEAVATFLIRHRFAEPIGGFQCVFPGC