Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00151 PIP4K2C PIP5K2C Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
24 1 1 JHU00151
24 1 2 JHU00151
HuProt v3.0
Block Row Column Clone
4 1 22 JHU00151
4 2 22 JHU00151
HuProt v3.1
Block Row Column Clone
4 1 22 JHU00151
4 2 22 JHU00151

External Database ID

Nucleotide (1266bp)

>JHU00151
ATGGCGTCCTCCTCGGTCCCACCAGCCACGGTATCGGCGGCGACAGCAGGCCCCGGCCCAGGTTTCGGCTTCGCCTCCAA
GACCAAGAAGAAGCATTTCGTGCAGCAGAAGGTGAAGGTGTTCCGGGCGGCCGACCCGCTGGTGGGTGTGTTCCTGTGGG
GCGTAGCCCACTCGATCAATGAGCTCAGCCAGGTGCCTCCCCCGGTGATGCTGCTGCCAGATGACTTTAAGGCCAGCTCC
AAGATCAAGGTCAACAATCACCTTTTCCACAGGGAAAATCTGCCCAGTCATTTCAAGTTCAAGGAGTATTGTCCCCAGGT
CTTCAGGAACCTCCGTGATCGATTTGGCATTGATGACCAAGATTACTTGGTGTCCCTTACCCGAAACCCCCCCAGCGAAA
GTGAAGGCAGTGATGGTCGCTTCCTTATCTCCTACGATCGGACTCTGGTCATCAAAGAAGTATCCAGTGAGGACATTGCT
GACATGCATAGCAACCTCTCCAACTATCACCAGTACATTGTGAAGTGCCATGGCAACACGCTTCTGCCCCAGTTCCTGGG
GATGTACCGAGTCAGTGTGGACAACGAAGACAGCTACATGCTTGTGATGCGCAATATGTTTAGCCACCGTCTTCCTGTGC
ACAGGAAGTATGACCTCAAGGGTTCCCTAGTGTCCCGGGAAGCCAGCGATAAGGAAAAGGTTAAAGAATTGCCCACCCTT
AGGGATATGGACTTTCTCAACAAGAACCAGAAAGTATATATTGGTGAAGAGGAGAAGAAAATATTTCTGGAGAAGCTGAA
GAGAGATGTGGAGTTTCTAGTGCAGCTGAAGATCATGGACTACAGCCTTCTGCTAGGCATCCACGACATCATTCGGGGCT
CTGAACCAGAGGAGGAAGCGCCCGTGCGGGAGGATGAGTCAGAGGTGGATGGGGACTGCAGCCTGACTGGACCTCCTGCT
CTGGTGGGCTCCTATGGCACCTCCCCAGAGGGTATCGGAGGCTACATCCATTCCCATCGGCCCCTGGGCCCAGGAGAGTT
TGAGTCCTTCATTGATGTCTATGCCATCCGGAGTGCTGAAGGAGCCCCCCAGAAGGAGGTCTACTTCATGGGCCTCATTG
ATATCCTTACACAGTATGATGCCAAGAAGAAAGCAGCTCATGCAGCCAAAACTGTCAAGCATGGGGCTGGGGCAGAGATC
TCTACTGTCCATCCGGAGCAGTATGCTAAGCGATTCCTGGATTTTATTACCAACATCTTTGCCTAG

Protein (421aa)

>JHU00151
MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVMLLPDDFKASS
KIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIA
DMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL
RDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPA
LVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEI
STVHPEQYAKRFLDFITNIFA