Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00015 CDKN1A CAP20;CDKN1;CIP1;MDA6;PIC1;SDI1;WAF1 Homo sapiens Yes Cell Death; Kinases; Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
10 1 9 JHU00015
10 1 10 JHU00015
HuProt v3.0
Block Row Column Clone
2 1 15 JHU00015
2 2 15 JHU00015
HuProt v3.1
Block Row Column Clone
2 1 15 JHU00015
2 2 15 JHU00015

External Database ID

Nucleotide (495bp)

>JHU00015
ATGTCAGAACCGGCTGGGGATGTCCGTCAGAACCCATGCGGCAGCAAGGCCTGCCGCCGCCTCTTCGGCCCAGTGGACAG
CGAGCAGCTGAGCCGCGACTGTGATGCGCTAATGGCGGGCTGCATCCAGGAGGCCCGTGAGCGATGGAACTTCGACTTTG
TCACCGAGACACCACTGGAGGGTGACTTCGCCTGGGAGCGTGTGCGGGGCCTTGGCCTGCCCAAGCTCTACCTTCCCACG
GGGCCCCGGCGAGGCCGGGATGAGTTGGGAGGAGGCAGGCGGCCTGGCACCTCACCTGCTCTGCTGCAGGGGACAGCAGA
GGAAGACCATGTGGACCTGTCACTGTCTTGTACCCTTGTGCCTCGCTCAGGGGAGCAGGCTGAAGGGTCCCCAGGTGGAC
CTGGAGACTCTCAGGGTCGAAAACGGCGGCAGACCAGCATGACAGATTTCTACCACTCCAAACGCCGGCTGATCTTCTCC
AAGAGGAAGCCCTAG

Protein (164aa)

>JHU00015
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPT
GPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFS
KRKP