Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00144 NEK11 Homo sapiens Yes Kinases; Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
14 1 13 JHU00144
14 1 14 JHU00144
HuProt v3.0
Block Row Column Clone
1 1 29 JHU00144
1 2 29 JHU00144
HuProt v3.1
Block Row Column Clone
1 1 29 JHU00144
1 2 29 JHU00144

External Database ID

Nucleotide (1449bp)

>JHU00144
ATGCTGAAATTCCAAGAGGCAGCTAAGTGTGTGAGTGGATCAACAGCCATTTCCACTTATCCAAAGACCTTGATTGCAAG
AAGATACGTGCTTCAACAAAAACTTGGCAGTGGAAGTTTTGGAACTGTCTATCTGGTTTCAGACAAGAAAGCCAAACGAG
GAGAGGAATTAAAGGTACTTAAGGAAATATCTGTTGGAGAACTAAATCCAAATGAAACTGTACAGGCCAATTTGGAAGCC
CAACTCCTCTCCAAGCTGGACCACCCAGCCATTGTCAAGTTCCATGCAAGTTTTGTGGAGCAAGATAATTTCTGCATTAT
CACGGAGTACTGTGAGGGCCGAGATCTGGACGATAAAATTCAGGAATATAAACAAGCTGGAAAAATCTTTCCAGAAAATC
AAATAATAGAATGGTTTATCCAGCTGCTGCTGGGAGTTGACTACATGCATGAGAGGAGGATACTTCATCGAGACTTAAAG
TCAAAGAATGTATTTCTGAAAAATAATCTCCTTAAAATTGGAGATTTTGGAGTTTCTCGACTTCTAATGGGATCCTGTGA
CCTGGCCACAACTTTAACTGGAACTCCCCATTATATGAGTCCTGAGGCTCTGAAACACCAAGGCTATGACACAAAGTCGG
ACATCTGGTCACTGGCATGCATTTTGTATGAGATGTGCTGCATGAATCATGCATTCGCTGGCTCCAATTTCTTATCCATT
GTTTTAAAAATTGTTGAAGGTGACACACCTTCTCTCCCTGAGAGATATCCAAAAGAACTAAATGCCATCATGGAAAGCAT
GTTGAACAAGAATCCTTCATTAAGACCATCTGCTATCGAAATTTTAAAAATCCCTTACCTTGATGAGCAGCTACAGAACC
TAATGTGTAGATATTCAGAAATGACTCTGGAAGACAAAAATTTGGATTGTCAGAAGGAGGCTGCTCATATAATTAATGCC
ATGCAAAAAAGGATCCACCTGCAGACTCTGAGGGCACTGTCAGAAGTACAGAAAATGACGCCAAGAGAAAGGATGCGGCT
GAGGAAGCTCCAGGCGGCTGATGAGAAAGCCAGGAAGCTGAAAAAGATTGTGGAAGAAAAATATGAAGAAAATAGCAAAC
GAATGCAAGAATTGAGATCTCGGAACTTTCAGCAGCTGAGTGTTGATGTACTCCATGAAAAAACACATTTAAAAGGAATG
GAAGAAAAGGAGGAGCAACCTGAGGGAAGACTTTCTTGTTCACCCCAGGACGAGGATGAAGAGAGGTGGCAAGGCAGGGA
AGAGGAATCTGATGAACCAACTTTAGAGAACCTGCCTGAGTCTCAGCCTATTCCTTCCATGGACCTCCACGAACTTGAAT
CAATTGTAGAGGATGCCACATCTGACCTTGGATACCATGGAGACTGTAATCTAATTTCACTAGACGAATACTGGAAAAAT
GAAAAATAG

Protein (482aa)

>JHU00144
MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVLKEISVGELNPNETVQANLEA
QLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLK
SKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSI
VLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINA
MQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKLKKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGM
EEKEEQPEGRLSCSPQDEDEERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHGDCNLISLDEYWKN
EK