Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU14136 PDE6D PDED Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
27 1 11 JHU14136
27 1 12 JHU14136
31 1 7 JHU14136
31 1 8 JHU14136
29 1 11 JHU14136
29 1 12 JHU14136
31 1 15 JHU14136
31 1 16 JHU14136
29 19 9 JHU14136
29 19 10 JHU14136
HuProt v3.0
Block Row Column Clone
2 5 16 JHU14136
2 6 16 JHU14136
3 5 30 JHU14136
3 6 30 JHU14136
2 5 13 JHU14136
2 6 13 JHU14136
1 5 30 JHU14136
1 6 30 JHU14136
14 37 31 JHU14136
14 38 31 JHU14136
HuProt v3.1
Block Row Column Clone
2 5 16 JHU14136
2 6 16 JHU14136
3 5 30 JHU14136
3 6 30 JHU14136
2 5 13 JHU14136
2 6 13 JHU14136
1 5 30 JHU14136
1 6 30 JHU14136
14 37 31 JHU14136
14 38 31 JHU14136

External Database ID

Nucleotide (453bp)

>JHU14136
ATGTCAGCCAAGGACGAGCGGGCCAGGGAGATCCTGAGGGGCTTCAAACTAAATTGGATGAACCTTCGGGATGCTGAGAC
AGGGAAGATACTCTGGCAAGGAACAGAAGACCTGTCTGTCCCTGGTGTGGAGCATGAAGCCCGTGTTCCCAAGAAAATCC
TCAAGTGCAAGGCAGTGTCTCGAGAACTTAATTTTTCTTCGACAGAACAAATGGAAAAATTCCGCCTGGAACAAAAAGTT
TACTTCAAAGGGCAATGCCTAGAAGAATGGTTCTTCGAGTTTGGCTTTGTGATCCCTAACTCCACAAATACCTGGCAGTC
CTTGATAGAGGCAGCACCCGAGTCCCAGATGATGCCAGCAAGCGTCTTAACTGGGAACGTTATCATAGAAACAAAGTTTT
TTGACGACGATCTTCTTGTAAGCACATCCAGAGTGAGACTTTTCTATGTTTAG

Protein (150aa)

>JHU14136
MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQMEKFRLEQKV
YFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV