Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00014 CDK7 CAK;CAK1;CDKN7;MO15;STK1 Homo sapiens Yes Kinases; Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
10 1 7 JHU00014
10 1 8 JHU00014
HuProt v3.0
Block Row Column Clone
3 3 23 JHU00014
3 4 23 JHU00014
HuProt v3.1
Block Row Column Clone
3 3 23 JHU00014
3 4 23 JHU00014

External Database ID

Nucleotide (1041bp)

>JHU00014
ATGGCTCTGGACGTGAAGTCTCGGGCAAAGCGTTATGAGAAGCTGGACTTCCTTGGGGAGGGACAGTTTGCCACCGTTTA
CAAGGCCAGAGATAAGAACACCAACCAAATTGTCGCCATTAAGAAAATCAAACTTGGACATAGATCAGAAGCTAAAGATG
GTATAAATAGAACCGCCTTAAGAGAGATAAAATTATTACAGGAGCTAAGTCATCCAAATATAATTGGTCTCCTTGATGCT
TTTGGACATAAATCTAATATTAGCCTTGTCTTTGATTTTATGGAAACTGATCTAGAGGTTATAATAAAGGATAATAGTCT
TGTGCTGACACCATCACACATCAAAGCCTACATGTTGATGACTCTTCAAGGATTAGAATATTTACATCGACATTGGATCC
TACATAGGGATCTGAAACCAAACAACTTGTTGCTAGATGAAAATGGAGTTCTAAAACTGGCAGATTTTGGCCTGGCCAAA
TCTTTTGGGAGCCCCAATAGAGCTTATACACATCAGGTTGTAACCAGGTGGTATCGGGCCCCCGAGTTACTATTTGGAGC
TAGGATGTATGGTGTAGGTGTGGACATGTGGGCTGTTGGCTGTATATTAGCAGAGTTACTTCTAAGGGTTCCTTTTTTGC
CAGGAGATTCAGACCTTGATCAGCTAACAAGAATATTTGAAACTTTGGGCACACCAACTGAGGAACAGTGGCCGGACATG
TGTAGTCTTCCAGATTATGTGACATTTAAGAGTTTCCCTGGAATACCTTTGCATCACATCTTCAGTGCAGCAGGAGACGA
CTTACTAGATCTCATACAAGGCTTATTCTTATTTAATCCATGTGCTCGAATTACGGCCACACAGGCACTGAAAATGAAGT
ATTTCAGTAATCGGCCAGGGCCAACACCTGGATGTCAGCTGCCAAGACCAAACTGTCCAGTGGAAACCTTAAAGGAGCAA
TCAAATCCAGCTTTGGCAATAAAAAGGAAAAGAACAGAGGCCTTAGAACAAGGAGGATTGCCCAAGAAACTAATTTTTTA
G

Protein (346aa)

>JHU00014
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDA
FGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHRHWILHRDLKPNNLLLDENGVLKLADFGLAK
SFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQ
SNPALAIKRKRTEALEQGGLPKKLIF