Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU13880 ZNF213 ZKSCAN21 Homo sapiens Yes Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
12 19 13 JHU13880
12 19 14 JHU13880
19 26 5 JHU13880
19 26 6 JHU13880
17 26 5 JHU13880
17 26 6 JHU13880
42 26 25 JHU13880
42 26 26 JHU13880
2 26 27 JHU13880
2 26 28 JHU13880
HuProt v3.0
Block Row Column Clone
13 37 12 JHU13880
13 38 12 JHU13880
23 1 4 JHU13880
23 2 4 JHU13880
23 1 19 JHU13880
23 2 19 JHU13880
22 9 15 JHU13880
22 10 15 JHU13880
22 9 3 JHU13880
22 10 3 JHU13880
HuProt v3.1
Block Row Column Clone
13 37 12 JHU13880
13 38 12 JHU13880
23 1 4 JHU13880
23 2 4 JHU13880
23 1 19 JHU13880
23 2 19 JHU13880
22 9 15 JHU13880
22 10 15 JHU13880
22 9 3 JHU13880
22 10 3 JHU13880

External Database ID

Nucleotide (1380bp)

>JHU13880
ATGGCAGCCCCCTTGGAGGCCCAGGACCAGGCCCCTGGGGAGGGAGAAGGGCTTCTGATTGTGAAAGTGGAAGATTCCTC
CTGGGAACAGGAATCTGCCCAGCATGAGGATGGCAGGGATTCCGAAGCCTGCCGCCAGCGCTTCCGGCAATTCTGCTACG
GGGATGTGCATGGGCCTCATGAGGCCTTCAGCCAGCTCTGGGAGCTCTGCTGCCGCTGGCTGCGGCCCGAGCTGCGTACC
AAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGTTCCTGACAGTGCTGCCAGGGGAGATCCAGGGCTGGGTGCGTGA
GCAGCACCCGGGAAGCGGTGAGGAGGCTGTCGCCTTGGTGGAGGACCTACAGAAGCAGCCAGTGAAAGCCTGGCGACAGG
ATGTGCCCTCGGAGGAGGCGGAACCCGAGGCTGCAGGCCGGGGATCCCAGGCCACGGGGCCTCCCCCGACGGTGGGGGCA
CGGAGGCGGCCGTCTGTTCCCCAGGAGCAGCACAGCCATAGCGCCCAGCCTCCTGCTCTTCTTAAAGAGGGTCGTCCCGG
AGAGACGACGGACACCTGCTTTGTCTCTGGGGTCCATGGACCTGTGGCATTGGGAGACATCCCATTCTATTTCTCCCGGG
AAGAATGGGGCACCCTGGACCCTGCTCAGCGGGATCTCTTCTGGGACATAAAGCGGGAGAACTCCCGGAACACCACCCTG
GGTTTTGGGCTCAAAGGCCAAAGTGAGAAGTCCCTGCTGCAGGAGATGGTGCCGGTGGTGCCAGGCCAGACAGGCAGCGA
CGTGACTGTGTCCTGGAGCCCCGAGGAGGCTGAGGCCTGGGAGAGCGAGAACCGGCCGAGGGCGGCCCTGGGCCCAGTGG
TGGGCGCGCGACGGGGGCGGCCACCCACTCGCCGGCGCCAGTTCCGGGACCTGGCAGCCGAGAAGCCGCACAGCTGCGGG
CAGTGTGGAAAGCGCTTCCGCTGGGGCTCGGACCTGGCGCGGCACCAGCGCACGCACACGGGCGAGAAGCCACACAAGTG
CCCTGAGTGCGACAAGAGCTTCCGCAGCTCCTCGGACCTGGTGCGCCACCAAGGCGTGCACACGGGCGAGAAGCCCTTCT
CCTGTTCCGAGTGCGGCAAGAGCTTCAGCCGCAGCGCCTACCTGGCCGACCACCAGCGCATACACACGGGCGAGAAGCCT
TTCGGCTGCAGCGACTGCGGCAAGAGCTTCTCGCTGCGCTCCTACCTGCTGGACCATCGGCGTGTGCACACCGGTGAGCG
GCCCTTCGGCTGCGGAGAGTGCGACAAGAGCTTCAAGCAGCGCGCGCACCTCATCGCGCATCAGAGCCTGCACGCCAAGA
TGGCCCAGCCCGTGGGGTAG

Protein (459aa)

>JHU13880
MAAPLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQFCYGDVHGPHEAFSQLWELCCRWLRPELRT
KEQILELLVLEQFLTVLPGEIQGWVREQHPGSGEEAVALVEDLQKQPVKAWRQDVPSEEAEPEAAGRGSQATGPPPTVGA
RRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRNTTL
GFGLKGQSEKSLLQEMVPVVPGQTGSDVTVSWSPEEAEAWESENRPRAALGPVVGARRGRPPTRRRQFRDLAAEKPHSCG
QCGKRFRWGSDLARHQRTHTGEKPHKCPECDKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKP
FGCSDCGKSFSLRSYLLDHRRVHTGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPVG