Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00135 GKAP1 GKAP42 Homo sapiens Yes Kinases; Signal Transduction

HuProt v2.0
Block Row Column Clone
8 1 5 JHU00135
8 1 6 JHU00135
HuProt v3.0
Block Row Column Clone
3 1 8 JHU00135
3 2 8 JHU00135
HuProt v3.1
Block Row Column Clone
3 1 8 JHU00135
3 2 8 JHU00135

External Database ID

Nucleotide (1101bp)

>JHU00135
ATGGCCTCAGCAGTACTTAGTTCTGTTCCCACCACCGCTTCTCGTTTTGCCCTGTTACAAGTGGATAGTGGCAGTGGCTC
TGATTCTGAACCTGGAAAAGGTAAAGGTCGAAATACTGGAAAGTCTCAAACTTTAGGAAGCAAGTCAACTACAAATGAGA
AAAAAAGAGAGAAAAGAAGAAAAAAGAAGGAACAGCAACAGAGTGAAGCAAATGAGCTCAGGAATCTTGCTTTTAAGAAA
ATTCCCCAGAAATCCTCCCATGCTGTTTGTAACGCTCAACATGATCTTCCATTGTCAAACCCAGTACAGAAGGATTCACG
AGAAGAAAATTGGCAAGAGTGGAGACAAAGAGATGAGCAGCTGACATCTGAAATGTTTGAAGCAGATCTTGAGAAGGCAT
TGTTACTAAGTAAACTAGAATATGAAGAGCACAAAAAGGAGTATGAAGATGCTGAAAATACTTCAACTCAGTCCAAAGTT
ATGAATAAAAAAGATAAAAGAAAGAATCATCAGGGAAAAGACAGACCTCTCACAGTATCACTAAAAGATTTTCATTCGGA
AGATCACATTAGTAAAAAGACTGAGGAATTGAGTTCTTCTCAGACTTTATCACATGATGGAGGATTCTTCAATAGACTGG
AAGATGATGTTCATAAAATTCTTATTAGAGAAAAACGAAGAGAACAGCTTACAGAATATAATGGAACAGATAATTGTACA
GCTCATGAACACAACCAGGAAGTGGTTCTGAAAGATGGAAGAATTGAAAGACTAAAGTTAGAGCTTGAAAGGAAAGATGC
TGAAATCCAGAAGCTGAAAAATGTAATCACTCAATGGGAGGCAAAGTATAAGGAAGTAAAGGCAAGAAATGCACAATTAT
TGAAAATGCTTCAGGAAGGTGAAATGAAAGATAAGGCAGAAATACTTCTGCAAGTTGATGAATCACAAAGTATCAAGAAT
GAGCTCACTATTCAGGTGACTTCACTTCATGCTGCATTAGAACAAGAAAGATCTAAAGTGAAAGTATTACAAGCAGAGTT
AGCCAAATACCAGGGTGGCAGAAAAGGGAAAAGAAACTCTGAATCCGACCAGTGTAGGTAG

Protein (366aa)

>JHU00135
MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEANELRNLAFKK
IPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLEYEEHKKEYEDAENTSTQSKV
MNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEELSSSQTLSHDGGFFNRLEDDVHKILIREKRREQLTEYNGTDNCT
AHEHNQEVVLKDGRIERLKLELERKDAEIQKLKNVITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKN
ELTIQVTSLHAALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR