Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU01332 SYF2 CBPIN;GCIPIP Homo sapiens Yes Nuclear Proteins

HuProt v2.0
Block Row Column Clone
8 1 15 JHU01332
8 1 16 JHU01332
19 1 1 JHU01332
19 1 2 JHU01332
8 2 25 JHU01332
8 2 26 JHU01332
6 2 29 JHU01332
6 2 30 JHU01332
HuProt v3.0
Block Row Column Clone
1 3 22 JHU01332
1 4 22 JHU01332
4 1 4 JHU01332
4 2 4 JHU01332
2 19 8 JHU01332
2 20 8 JHU01332
1 19 9 JHU01332
1 20 9 JHU01332
HuProt v3.1
Block Row Column Clone
1 3 22 JHU01332
1 4 22 JHU01332
4 1 4 JHU01332
4 2 4 JHU01332
2 19 8 JHU01332
2 20 8 JHU01332
1 19 9 JHU01332
1 20 9 JHU01332

External Database ID

Nucleotide (732bp)

>JHU01332
ATGGCGGCTATAGCTGCATCCGAGGTGCTGGTGGACAGCGCGGAGGAGGGGTCCCTCGCTGCGGCGGCGGAGCTGGCCGC
TCAGAAGCGCGAACAGAGACTGCGCAAATTCCGGGAGCTGCACCTGATGCGGAATGAAGCTCGTAAATTAAATCACCAGG
AAGTTGTGGAAGAAGATAAAAGACTAAAATTACCTGCAAATTGGGAAGCCAAAAAAGCTCGTTTGGAGTGGGAACTAAAG
GAAGAGGAAAAGAAAAAGGAATGTGCGGCAAGAGGAGAAGACTATGAGAAAGTGAAGTTGCTGGAGATCAGTGCAGAAGA
TGCAGAAAGATGGGAGAGGAAAAAGAAGAGGAAAAACCCTGATCTGGGATTTTCAGATTATGCTGCTGCCCAGTTACGCC
AGTATCATCGGTTGACCAAGCAGATCAAACCTGACATGGAAACATATGAGAGACTGAGAGAAAAACATGGAGAAGAGTTT
TTCCCAACATCCAATAGTCTTCTTCATGGAACACATGTGCCTTCCACAGAGGAAATTGACAGGATGGTCATAGATCTGGA
AAAACAGATTGAAAAACGAGACAAATATAGCCGGAGACGTCCTTATAATGATGATGCAGATATCGACTACATTAATGAAA
GGAATGCCAAATTCAACAAGAAAGCTGAAAGATTCTATGGGAAATACACAGCTGAAATTAAACAGAATTTGGAAAGAGGA
ACAGCTGTCTAG

Protein (243aa)

>JHU01332
MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELK
EEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEF
FPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERG
TAV