Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00133 FGGY Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
16 1 5 JHU00133
16 1 6 JHU00133
HuProt v3.0
Block Row Column Clone
3 1 14 JHU00133
3 2 14 JHU00133
HuProt v3.1
Block Row Column Clone
3 1 14 JHU00133
3 2 14 JHU00133

External Database ID
  • Reviewed UniProt: Q96C11-2 (FGGY_HUMAN)

Nucleotide (1320bp)

>JHU00133
ATGTGGCTGGACCATCGAGCAGTCAGTCAAGTTAACAGGATCAATGAGACCAAGCACAGTGTCCTCCAGTACGTCGGGGG
GGTGATGTCTGTGGAAATGCAGGCCCCGAAACTTCTGTGGCTGAAAGAGAACTTGAGAGAGATTTGCTGGGATAAGGCGG
GACATTTCTTTGATCTCCCGGACTTCTTATCGTGGAAGGCAACAGGTGTCACAGCACGGTCTCTCTGCTCCCTGGTGTGT
AAGTGGACATATTCAGCAGAGAAAGGCTGGGACGACAGTTTCTGGAAAATGATTGGTTTGGAAGACTTTGTTGCAGATAA
TTACAGCAAAATAGGAAACCAAGTGCTACCTCCTGGAGCTTCTCTTGGAAATGGGCTCACACCAGAGGCAGCAAGAGACC
TTGGCCTTCTCCCTGGGATTGCGGTCGCAGCTTCACTCATTGATGCCCATGCAGGAGGACTAGGAGTGATTGGGGCAGAT
GTGAGAGGGCACGGCCTCATCTGTGAGGGGCAGCCAGTGACGTCACGGCTGGCTGTCATCTGTGGAACGTCTTCTTGTCA
CATGGGGATCAGCAAAGACCCGATTTTTGTACCAGGCGTCTGGGGGCCTTATTTCTCAGCCATGGTACCTGGGTTCTGGC
TGAATGAAGGTGGTCAGAGCGTTACTGGAAAATTGATAGACCACATGGTACAAGGCCATGCTGCTTTTCCAGAACTACAA
GTAAAGGCCACAGCCAGATGCCAGAGTATATATGCATATTTGAACAGTCACCTGGATCTGATTAAGAAGGCTCAGCCTGT
GGGTTTCCTTACTGTTGATTTACATGTTTGGCCAGATTTCCATGGCAACCGGTCTCCCTTAGCAGATCTGACACTAAAGG
GCATGGTCACCGGATTGAAACTGTCTCAGGACCTTGATGATCTTGCCATTCTCTACCTGGCCACAGTTCAAGCCATTGCT
TTGGGGACTCGCTTCATTATAGAAGCCATGGAGGCAGCAGGGCACTCAATCAGTACTCTTTTCCTATGTGGAGGCCTCAG
CAAGAATCCCCTTTTTGTGCAAATGCATGCGGACATTACTGGCATGCCTGTGGTCCTGTCGCAAGAGGTGGAGTCCGTTC
TTGTGGGTGCTGCTGTTCTGGGTGCCTGTGCCTCAGGGGATTTCGCTTCTGTACAGGAAGCAATGGCAAAAATGAGCAAA
GTTGGGAAAGTTGTGTTCCCGAGACTACAGGATAAAAAATACTATGATAAGAAATACCAAGTATTCCTGAAGCTGGTTGA
ACACCAGAAGGAGTATTTGGCGATCATGAATGATGACTAG

Protein (439aa)

>JHU00133
MWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVC
KWTYSAEKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLPGIAVAASLIDAHAGGLGVIGAD
VRGHGLICEGQPVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQ
VKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIA
LGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSK
VGKVVFPRLQDKKYYDKKYQVFLKLVEHQKEYLAIMNDD