Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU13229 ERO1A ERO1L Homo sapiens Yes Cell Death; Secreted Proteins

HuProt v2.0
Block Row Column Clone
45 1 7 JHU13229
45 1 8 JHU13229
45 1 15 JHU13229
45 1 16 JHU13229
18 1 27 JHU13229
18 1 28 JHU13229
41 18 3 JHU13229
41 18 4 JHU13229
HuProt v3.0
Block Row Column Clone
3 5 31 JHU13229
3 6 31 JHU13229
1 5 31 JHU13229
1 6 31 JHU13229
2 11 5 JHU13229
2 12 5 JHU13229
16 29 25 JHU13229
16 30 25 JHU13229
HuProt v3.1
Block Row Column Clone
3 5 31 JHU13229
3 6 31 JHU13229
1 5 31 JHU13229
1 6 31 JHU13229
2 11 5 JHU13229
2 12 5 JHU13229
16 29 25 JHU13229
16 30 25 JHU13229

External Database ID

Nucleotide (1407bp)

>JHU13229
ATGGGCCGCGGCTGGGGATTCTTGTTTGGCCTCCTGGGCGCCGTGTGGCTGCTCAGCTCGGGCCACGGAGAGGAGCAGCC
CCCGGAGACAGCGGCACAGAGGTGCTTCTGCCAGGTTAGTGGTTACTTGGATGATTGTACCTGTGATGTTGAAACCATTG
ATAGATTTAATAACTACAGGCTTTTCCCAAGACTACAAAAACTTCTTGAAAGTGACTACTTTAGGTATTACAAGGTAAAC
CTGAAGAGGCCGTGTCCTTTCTGGAATGACATCAGCCAGTGTGGAAGAAGGGACTGTGCTGTCAAACCATGTCAATCTGA
TGAAGTTCCTGATGGAATTAAATCTGCGAGCTACAAGTATTCTGAAGAAGCCAATAATCTCATTGAAGAATGTGAACAAG
CTGAACGACTTGGAGCAGTGGATGAATCTCTGAGTGAGGAAACACAGAAGGCTGTTCTTCAGTGGACCAAGCATGATGAT
TCTTCAGATAACTTCTGTGAAGCTGATGACATTCAGTCCCCTGAAGCTGAATATGTAGATTTGCTTCTTAATCCTGAGCG
CTACACTGGTTACAAGGGACCAGATGCTTGGAAAATATGGAATGTCATCTACGAAGAAAACTGTTTTAAGCCACAGACAA
TTAAAAGACCTTTAAATCCTTTGGCTTCTGGTCAAGGGACAAGTGAAGAGAACACTTTTTACAGTTGGCTAGAAGGTCTC
TGTGTAGAAAAAAGAGCATTCTACAGACTTATATCTGGCCTACATGCAAGCATTAATGTGCATTTGAGTGCAAGATATCT
TTTACAAGAGACCTGGTTAGAAAAGAAATGGGGACACAACATTACAGAATTTCAACAGCGATTTGATGGAATTTTGACTG
AAGGAGAAGGTCCAAGAAGGCTTAAGAACTTGTATTTTCTCTACTTAATAGAACTAAGGGCTTTATCCAAAGTGTTACCA
TTCTTCGAGCGCCCAGATTTTCAACTCTTTACTGGAAATAAAATTCAGGATGAGGAAAACAAAATGTTACTTCTGGAAAT
ACTTCATGAAATCAAGTCATTTCCTTTGCATTTTGATGAGAATTCATTTTTTGCTGGGGATAAAAAAGAAGCACACAAAC
TAAAGGAGGACTTTCGACTGCATTTTAGAAATATTTCAAGAATTATGGATTGTGTTGGTTGTTTTAAATGTCGTCTGTGG
GGAAAGCTTCAGACTCAGGGTTTGGGCACTGCTCTGAAGATCTTATTTTCTGAGAAATTGATAGCAAATATGCCAGAAAG
TGGACCTAGTTATGAATTCCATCTAACCAGACAAGAAATAGTATCATTATTCAACGCATTTGGAAGAATTTCTACAAGTG
TGAAAAAATTAGAAAACTTCAGGAACTTGTTACAGAATATTCATTAG

Protein (468aa)

>JHU13229
MGRGWGFLFGLLGAVWLLSSGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLESDYFRYYKVN
LKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDD
SSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGTSEENTFYSWLEGL
CVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLP
FFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDENSFFAGDKKEAHKLKEDFRLHFRNISRIMDCVGCFKCRLW
GKLQTQGLGTALKILFSEKLIANMPESGPSYEFHLTRQEIVSLFNAFGRISTSVKKLENFRNLLQNIH