Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00129 ENPP4 KIAA0879;NPP4 Homo sapiens Yes Membrane Proteins; Metabolism

HuProt v2.0
Block Row Column Clone
38 1 7 JHU00129
38 1 8 JHU00129
47 24 29 JHU00129
47 24 30 JHU00129
HuProt v3.0
Block Row Column Clone
3 5 17 JHU00129
3 6 17 JHU00129
17 45 30 JHU00129
17 46 30 JHU00129
HuProt v3.1
Block Row Column Clone
3 5 17 JHU00129
3 6 17 JHU00129
17 45 30 JHU00129
17 46 30 JHU00129

External Database ID

Nucleotide (1362bp)

>JHU00129
ATGAAGTTATTAGTAATACTTTTGTTTTCTGGACTTATAACTGGTTTTAGAAGTGACTCTTCCTCTAGTTTGCCACCTAA
GTTACTACTAGTATCCTTTGATGGCTTCAGAGCTGATTATCTGAAGAACTATGAATTTCCTCATCTCCAGAATTTTATCA
AAGAAGGTGTTTTGGTAGAGCATGTTAAAAATGTTTTTATCACAAAAACATTTCCAAACCACTACAGTATTGTGACAGGC
TTGTATGAAGAAAGCCATGGCATTGTGGCTAATTCCATGTATGATGCAGTCACAAAGAAACACTTTTCTGACTCTAATGA
CAAGGATCCTTTTTGGTGGAATGAGGCAGTACCTATTTGGGTGACCAATCAGCTTCAGGAAAACAGATCAAGTGCTGCTG
CTATGTGGCCTGGTACTGATGTACCCATTCACGATACCATCTCTTCCTATTTTATGAATTACAACTCCTCAGTGTCATTT
GAGGAAAGACTAAATAATATTACTATGTGGCTAAACAATTCGAACCCACCAGTCACCTTTGCAACACTATATTGGGAAGA
ACCAGATGCAAGTGGCCACAAATACGGACCTGAAGATAAAGAAAACATGAGCAGAGTGTTGAAAAAAATAGATGATCTTA
TCGGTGACTTAGTCCAAAGACTCAAGATGTTAGGGCTATGGGAAAATCTTAATGTGATCATTACAAGTGATCATGGGATG
ACCCAGTGTTCTCAGGACAGACTGATAAACCTGGATTCCTGCATCGATCATTCATACTACACTCTTATAGATTTGAGCCC
AGTTGCTGCAATACTTCCCAAAATAAATAGAACAGAGGTTTATAACAAACTGAAAAACTGTAGCCCTCATATGAATGTTT
ATCTCAAAGAAGACATTCCTAACAGATTTTATTACCAACATAATGATCGAATTCAGCCCATTATTTTGGTTGCCGATGAA
GGCTGGACAATTGTGCTAAATGAATCATCACAAAAATTAGGTGACCATGGTTATGATAATTCTTTGCCTAGTATGCATCC
ATTTCTAGCTGCCCACGGACCTGCATTTCACAAAGGCTACAAGCATAGCACAATTAACATTGTGGATATTTATCCAATGA
TGTGCCACATCCTGGGATTAAAACCACATCCCAATAATGGGACCTTTGGTCATACTAAGTGCTTGTTAGTTGACCAGTGG
TGCATTAATCTCCCAGAAGCCATCGCGATTGTTATCGGTTCACTCTTGGTGTTAACCATGCTAACATGCCTCATAATAAT
CATGCAGAATAGACTTTCTGTACCTCGTCCATTTTCTCGACTTCAGCTACAAGAAGATGATGATGATCCTTTAATTGGGT
AG

Protein (453aa)

>JHU00129
MKLLVILLFSGLITGFRSDSSSSLPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTG
LYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSF
EERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGM
TQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADE
GWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQW
CINLPEAIAIVIGSLLVLTMLTCLIIIMQNRLSVPRPFSRLQLQEDDDDPLIG