Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00128 DYRK2 Homo sapiens Yes Cell Death; Kinases; Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
32 1 9 JHU00128
32 1 10 JHU00128
HuProt v3.0
Block Row Column Clone
2 1 32 JHU00128
2 2 32 JHU00128
HuProt v3.1
Block Row Column Clone
2 1 32 JHU00128
2 2 32 JHU00128

External Database ID

Nucleotide (1587bp)

>JHU00128
ATGAATGATCACCTGCATGTCGGCAGCCACGCTCACGGACAGATCCAGGTTCAACAGTTGTTTGAGGATAACAGTAACAA
GCGGACAGTGCTCACGACACAACCAAATGGGCTTACAACAGTGGGCAAAACGGGCTTGCCAGTGGTGCCAGAGCGGCAGC
TGGACAGCATTCATAGACGGCAGGGGAGCTCCACCTCTCTAAAGTCCATGGAAGGCATGGGGAAGGTGAAAGCCACCCCC
ATGACACCTGAACAAGCAATGAAGCAATACATGCAAAAACTCACAGCCTTCGAACACCATGAGATTTTCAGCTACCCTGA
AATATATTTCTTGGGTCTAAATGCTAAGAAGCGCCAGGGCATGACAGGTGGGCCCAACAATGGTGGCTATGATGATGACC
AGGGATCATATGTGCAGGTGCCCCACGATCACGTGGCTTACAGGTATGAGGTCCTCAAGGTCATTGGGAAGGGGAGCTTT
GGGCAGGTGGTCAAGGCCTACGATCACAAAGTCCACCAGCACGTGGCCCTAAAGATGGTGCGGAATGAGAAGCGCTTCCA
CCGGCAAGCAGCGGAGGAGATCCGAATCCTGGAACACCTGCGGAAGCAGGACAAGGATAACACAATGAATGTCATCCATA
TGCTGGAGAATTTCACCTTCCGCAACCACATCTGCATGACGTTTGAGCTGCTGAGCATGAACCTCTATGAGCTCATCAAG
AAGAATAAATTCCAGGGCTTCAGTCTGCCTTTGGTTCGCAAGTTTGCCCACTCGATTCTGCAGTGCTTGGATGCTTTGCA
CAAAAACAGAATAATTCACTGTGACCTTAAGCCCGAGAACATTTTGTTAAAGCAGCAGGGTAGAAGCGGTATTAAAGTAA
TTGATTTTGGCTCCAGTTGTTACGAGCATCAGCGTGTCTACACGTACATCCAGTCGCGTTTTTACCGGGCTCCAGAAGTG
ATCCTTGGGGCCAGGTATGGCATGCCCATTGATATGTGGAGCCTGGGCTGCATTTTAGCAGAGCTCCTGACGGGTTACCC
CCTCTTGCCTGGGGAAGATGAAGGGGACCAGCTGGCCTGTATGATTGAACTGTTGGGCATGCCCTCACAGAAACTGCTGG
ATGCATCCAAACGAGCCAAAAATTTTGTGAGCTCCAAGGGTTATCCCCGTTACTGCACTGTCACGACTCTCTCAGATGGC
TCTGTGGTCCTAAACGGAGGCCGTTCCCGGAGGGGGAAACTGAGGGGCCCACCGGAGAGCAGAGAGTGGGGTAACGCGCT
GAAGGGGTGTGATGATCCCCTTTTCCTTGACTTCTTAAAACAGTGTTTAGAGTGGGATCCTGCAGTGCGCATGACCCCAG
GCCAGGCTTTGCGGCACCCCTGGCTGAGGAGGCGGTTGCCAAAGCCTCCCACCGGGGAGAAAACGTCAGTGAAAAGGATA
ACTGAGAGCACCGGTGCTATCACATCTATATCCAAGTTACCTCCACCTTCTAGCTCAGCTTCCAAACTGAGGACTAATTT
GGCGCAGATGACAGATGCCAATGGGAATATTCAGCAGAGGACAGTGTTGCCAAAACTTGTTAGCTAG

Protein (528aa)

>JHU00128
MNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSMEGMGKVKATP
MTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSF
GQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIK
KNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEV
ILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDG
SVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRI
TESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS