Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00120 DGUOK DGK Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
16 1 1 JHU00120
16 1 2 JHU00120
HuProt v3.0
Block Row Column Clone
4 1 14 JHU00120
4 2 14 JHU00120
HuProt v3.1
Block Row Column Clone
4 1 14 JHU00120
4 2 14 JHU00120
24 53 4 JHU00120
24 54 4 JHU00120

External Database ID

Nucleotide (834bp)

>JHU00120
ATGGCCGCGGGCCGCCTCTTTCTAAGTCGGCTTCGAGCACCCTTCAGTTCCATGGCCAAGAGCCCACTCGAGGGCGTTTC
CTCCTCCAGAGGCCTGCACGCGGGGCGCGGGCCCCGAAGGCTCTCCATCGAAGGCAACATTGCTGTGGGAAAGTCCACGT
TTGTGAAGTTACTCACGAAAACTTACCCAGAATGGCACGTAGCTACAGAACCTGTAGCAACATGGCAGAATATCCAGGCT
GCTGGCACCCAAAAAGCCTGCACTGCCCAAAGTCTTGGAAACTTGCTGGATATGATGTACCGGGAGCCAGCACGATGGTC
CTACACATTCCAGACATTTTCCTTTTTGAGCCGCCTGAAAGTACAGCTGGAGCCCTTCCCTGAGAAACTCTTACAGGCCA
GGAAGCCAGTACAGATCTTTGAGAGGTCTGTGTACAGTGACAGGTATATCTTTGCAAAGAATCTTTTTGAAAATGGTTCC
CTCAGTGACATCGAGTGGCATATCTATCAGGACTGGCATTCTTTTCTCCTGTGGGAGTTTGCCAGCCGGATCACATTACA
TGGCTTCATCTACCTCCAGGCTTCTCCCCAGGTTTGTTTGAAGAGACTGTACCAGAGGGCCAGGGAGGAGGAGAAAGGAA
TTGAGCTGGCCTATCTAGAGCAGCTGCATGGCCAACACGAAGCCTGGCTTATTCACAAGACAACGAAGCTCCACTTTGAG
GCTCTGATGAACATTCCAGTGCTGGTGTTGGATGTCAATGATGATTTTTCTGAGGAAGTAACCAAACAAGAAGACCTCAT
GAGAGAGGTAAACACCTTTGTAAAGAATCTGTAG

Protein (277aa)

>JHU00120
MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIAVGKSTFVKLLTKTYPEWHVATEPVATWQNIQA
AGTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQIFERSVYSDRYIFAKNLFENGS
LSDIEWHIYQDWHSFLLWEFASRITLHGFIYLQASPQVCLKRLYQRAREEEKGIELAYLEQLHGQHEAWLIHKTTKLHFE
ALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKNL