Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11895 TBL2 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
21 16 1 JHU11895
21 16 2 JHU11895
HuProt v3.0
Block Row Column Clone
16 1 21 JHU11895
16 2 21 JHU11895
HuProt v3.1
Block Row Column Clone
16 1 21 JHU11895
16 2 21 JHU11895

External Database ID

Nucleotide (228bp)

>JHU11895
ATGGAGCTCTCGCAGATGTCGGAGCTCATGGGGCTGTCGGTGTTGCTTGGGCTGCTGGCCCTGATGGCGACGGCGGCGGT
AGCGCGGGGGTGGCTGCGCGCGGGGGAGGAGAGGAGCGGCCGGCCCGCCTGGCCCAGGAGCTTTTTTCCTGTTGGAATTG
GGGAGCATCTGCAGTCATTTACCACATGCCAGCTTTGTGACTCAATTAAGTATCTTTTACAAAAGTAG

Protein (75aa)

>JHU11895
MELSQMSELMGLSVLLGLLALMATAAVARGWLRAGEERSGRPAWPRSFFPVGIGEHLQSFTTCQLCDSIKYLLQK