Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11892 ZFP3 ZNF752 Homo sapiens Yes Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
23 16 15 JHU11892
23 16 16 JHU11892
HuProt v3.0
Block Row Column Clone
13 5 10 JHU11892
13 6 10 JHU11892
HuProt v3.1
Block Row Column Clone
13 5 10 JHU11892
13 6 10 JHU11892

External Database ID

Nucleotide (1509bp)

>JHU11892
ATGGGGACTGAGAACAAGGAGGTGATTCCCAAGGAAGAAATTTCTGAAGAATCTGAGCCACATGGGTCATTATTAGAAAA
ATTTCCAAAAGTGGTTTACCAAGGTCATGAGTTTGGAGCAGGATGTGAAGAAGACATGTTGGAGGGACATTCGAGAGAGT
CCATGGAAGAGGTTATAGAGCAGATGTCTCCTCAGGAGAGAGACTTTCCATCAGGGTTGATGATCTTTAAGAAATCACCC
TCAAGTGAGAAAGACCGGGAGAATAATGAGAGTGAGAGAGGCTGCAGTCCCAGCCCAAATCTGGTTACACATCAGGGAGA
TACAACAGAGGGAGTTAGTGCATTTGCTACCTCTGGCCAAAACTTCCTAGAGATTTTAGAATCTAACAAAACACAGAGAA
GTTCTGTGGGAGAAAAGCCTCATACATGTAAAGAATGTGGGAAAGCCTTTAATCAGAACTCACATCTCATCCAGCATATG
AGAGTTCATAGTGGAGAAAAACCCTTTGAATGTAAAGAATGTGGAAAGACATTTGGAACTAATTCAAGCCTTCGACGGCA
CCTGAGAATTCATGCTGGAGAAAAACCCTTTGCTTGTAATGAATGTGGAAAGGCCTTCATTCAGAGTTCACACCTTATTC
ACCATCATAGAATTCATACTGGAGAGAGACCCTATAAATGTGAAGAATGTGGTAAAGCCTTCAGTCAAAATTCAGCCCTT
ATTCTACACCAGAGAATCCATACTGGAGAGAAACCATATGAATGTAATGAATGTGGGAAGACCTTTAGGGTTAGTTCACA
GCTTATTCAGCATCAGAGAATTCATACTGAAGAAAGATACCATGAATGCAATGAGTGTGGCAAAGCCTTCAAGCATAGCT
CAGGCCTTATTAGACACCAGAAAATTCATACTGGAGAAAAACCATATCTGTGTAATGAATGTGGGAAGGGCTTCGGGCAG
AGTTCTGAGCTTATCCGGCATCAGAGAATTCATACAGGGGACAAACCCTATGAATGTAATGAATGTGGGAAAACTTTTGG
CCAGAACTCAGAGATTATTAGACATATTAGAATTCATACTGGTGAGAAGCCCTATGTATGTAAGGAATGTGGGAAGGCCT
TCAGGGGGAACTCAGAACTTCTTAGACATGAGAGAATTCACACTGGAGAGAAACCCTATGAATGCTTTGAGTGTGGAAAG
GCTTTCAGGCGGACCTCTCACCTTATTGTCCACCAGAGAATTCATACTGGAGAGAAACCCCATCAATGTAATGAGTGTGC
AAGAACCTTTTGGGATAATTCTGAGCTGCTTCTCCACCAGAAAATTCATATTGGAGAGAAACCTTATGAATGTAGCGAGT
GTGAGAAAACATTTAGCCAGCATTCCCAACTTATCATACATCAGAGAATTCACACTGGAGAGAAGCCTTATGAGTGCCAA
GAATGTCAGAAGACTTTTAGTCGGAGCTCTCACCTCCTCCGACATCAAAGTGTTCACTGTATGGAGTAG

Protein (502aa)

>JHU11892
MGTENKEVIPKEEISEESEPHGSLLEKFPKVVYQGHEFGAGCEEDMLEGHSRESMEEVIEQMSPQERDFPSGLMIFKKSP
SSEKDRENNESERGCSPSPNLVTHQGDTTEGVSAFATSGQNFLEILESNKTQRSSVGEKPHTCKECGKAFNQNSHLIQHM
RVHSGEKPFECKECGKTFGTNSSLRRHLRIHAGEKPFACNECGKAFIQSSHLIHHHRIHTGERPYKCEECGKAFSQNSAL
ILHQRIHTGEKPYECNECGKTFRVSSQLIQHQRIHTEERYHECNECGKAFKHSSGLIRHQKIHTGEKPYLCNECGKGFGQ
SSELIRHQRIHTGDKPYECNECGKTFGQNSEIIRHIRIHTGEKPYVCKECGKAFRGNSELLRHERIHTGEKPYECFECGK
AFRRTSHLIVHQRIHTGEKPHQCNECARTFWDNSELLLHQKIHIGEKPYECSECEKTFSQHSQLIIHQRIHTGEKPYECQ
ECQKTFSRSSHLLRHQSVHCME