Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11891 ZBTB14 ZFP161;ZNF478 Homo sapiens Yes Kinases; Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
13 16 9 JHU11891
13 16 10 JHU11891
HuProt v3.0
Block Row Column Clone
14 1 13 JHU11891
14 2 13 JHU11891
HuProt v3.1
Block Row Column Clone
14 1 13 JHU11891
14 2 13 JHU11891
24 43 27 JHU11891
24 44 27 JHU11891

External Database ID

Nucleotide (1350bp)

>JHU11891
ATGGAGTTTTTCATCAGTATGTCTGAAACCATTAAATATAATGACGATGATCATAAAACTCTGTTTCTGAAAACACTAAA
TGAACAACGCCTGGAAGGAGAATTTTGTGATATTGCTATTGTGGTTGAGGATGTGAAATTCAGAGCACACAGATGTGTTC
TTGCTGCCTGCAGCACCTACTTTAAAAAGCTTTTCAAGAAGCTTGAGGTTGATAGTTCTTCGGTCATAGAAATAGATTTT
CTTCGTTCTGATATATTTGAAGAGGTCCTGAACTACATGTACACAGCAAAGATTTCCGTGAAAAAAGAAGATGTTAACTT
AATGATGTCATCGGGTCAGATTCTTGGTATCCGATTTTTGGATAAACTGTGTTCTCAGAAGCGTGATGTGTCCAGTCCCG
ATGAAAACAATGGTCAGTCCAAAAGTAAGTATTGCCTTAAAATAAATCGCCCCATTGGAGATGCTGCTGACACCCAGGAT
GATGATGTAGAGGAAATCGGGGATCAGGATGACAGTCCTTCTGATGACACAGTAGAAGGCACACCCCCGAGTCAGGAGGA
CGGCAAGTCGCCCACCACAACGCTCAGGGTTCAGGAAGCGATCCTGAAAGAGCTGGGGAGTGAGGAAGTTCGGAAGGTCA
ATTGCTACGGCCAGGAAGTAGAATCCATGGAGACCCCAGAATCAAAAGACTTGGGGTCCCAGACCCCTCAAGCCTTAACA
TTTAATGATGGGATGAGTGAAGTGAAAGATGAACAGACACCAGGCTGGACAACAGCCGCCAGTGACATGAAGTTTGAGTA
TTTGCTTTATGGTCACCATCGGGAGCAGATTGCCTGCCAGGCGTGTGGGAAGACGTTTTCTGATGAAGGCAGATTGAGGA
AGCATGAGAAACTCCACACGGCGGACAGGCCATTTGTTTGTGAAATGTGCACAAAAGGTTTCACCACACAGGCCCACCTG
AAAGAACACCTAAAAATCCACACAGGATATAAGCCCTATAGCTGTGAGGTGTGTGGAAAATCATTTATCCGTGCCCCAGA
CTTAAAGAAGCATGAGAGAGTTCACAGTAATGAAAGACCGTTTGCGTGCCACATGTGTGACAAAGCCTTCAAACACAAGT
CTCACCTCAAGGATCATGAAAGAAGACACAGAGGGGAAAAGCCTTTTGTGTGTGGCTCCTGCACCAAGGCATTTGCCAAG
GCATCTGATCTGAAAAGGCACGAGAACAATATGCACAGTGAAAGGAAGCAGGTTACCCCCAGTGCCATCCAGAGCGAGAC
AGAACAGTTGCAGGCGGCAGCGATGGCTGCGGAAGCAGAACAGCAGCTGGAGACGATAGCCTGTAGCTAG

Protein (449aa)

>JHU11891
MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTYFKKLFKKLEVDSSSVIEIDF
LRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQD
DDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALT
FNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHL
KEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAK
ASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS