Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11888 UBE2J2 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
31 16 1 JHU11888
31 16 2 JHU11888
HuProt v3.0
Block Row Column Clone
16 1 28 JHU11888
16 2 28 JHU11888
HuProt v3.1
Block Row Column Clone
16 1 28 JHU11888
16 2 28 JHU11888

External Database ID

Nucleotide (624bp)

>JHU11888
ATGACCCCTTATGAAGGTGGCTATTATCATGGAAAACTAATTTTTCCCAGAGAATTTCCTTTCAAACCTCCCAGTATCTA
TATGATCACTCCCAACGGGAGGTTTAAGTGCAACACCAGGCTGTGTCTTTCTATCACGGATTTCCACCCGGACACGTGGA
ACCCGGCCTGGTCTGTCTCCACCATCCTGACTGGGCTCCTGAGCTTCATGGTGGAGAAGGGCCCCACCCTGGGCAGTATA
GAGACGTCGGACTTCACGAAAAGACAACTGGCAGTGCAGAGTTTAGCATTTAATTTGAAAGATAAAGTCTTTTGTGAATT
ATTTCCTGAAGTCGTGGAGGAGATTAAACAAAAACAGAAAGCACAAGACGAACTCAGTAGCAGACCCCAGACTCTCCCCT
TGCCAGACGTGGTTCCAGACGGGGAGACGCACCTCGTCCAGAACGGGATTCAGCTGCTCAACGGGCATGCGCCGGGGGCC
GTCCCAAACCTCGCAGGGCTCCAGCAGGCCAACCGGCACCACGGACTCCTGGGTGGCGCCCTGGCGAACTTGTTTGTGAT
AGTTGGGTTTGCAGCCTTTGCTTACACGGTCAAGTACGTGCTGAGGAGCATCGCGCAGGAGTAG

Protein (207aa)

>JHU11888
MTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSI
ETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGA
VPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVKYVLRSIAQE