Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11878 SRSF9 SFRS9;SRP30C Homo sapiens Yes Nuclear Proteins

HuProt v2.0
Block Row Column Clone
31 16 15 JHU11878
31 16 16 JHU11878
HuProt v3.0
Block Row Column Clone
13 5 30 JHU11878
13 6 30 JHU11878
HuProt v3.1
Block Row Column Clone
13 5 30 JHU11878
13 6 30 JHU11878

External Database ID

Nucleotide (666bp)

>JHU11878
ATGTCGGGCTGGGCGGACGAGCGCGGCGGCGAGGGCGACGGGCGCATCTACGTGGGGAACCTTCCGACCGACGTGCGCGA
GAAGGACTTGGAGGACCTGTTCTACAAGTACGGCCGCATCCGCGAGATCGAGCTCAAGAACCGGCACGGCCTCGTGCCCT
TCGCCTTCGTGCGCTTCGAGGACCCCCGAGATGCAGAGGATGCTATTTATGGAAGAAATGGTTATGATTATGGCCAGTGT
CGGCTTCGTGTGGAGTTCCCCAGGACTTATGGAGGTCGGGGTGGGTGGCCCCGTGGTGGGAGGAATGGGCCTCCTACAAG
AAGATCTGATTTCCGAGTTCTTGTTTCAGGACTTCCTCCGTCAGGCAGCTGGCAGGACCTGAAGGATCACATGCGAGAAG
CTGGGGATGTCTGTTATGCTGATGTGCAGAAGGATGGAGTGGGGATGGTCGAGTATCTCAGAAAAGAAGACATGGAATAT
GCCCTGCGTAAACTGGATGACACCAAATTCCGCTCTCATGAGGGTGAAACTTCCTACATCCGAGTTTATCCTGAGAGAAG
CACCAGCTATGGCTACTCACGGTCTCGGTCTGGGTCAAGGGGCCGTGACTCTCCATACCAAAGCAGGGGTTCCCCACACT
ACTTCTCTCCTTTCAGGCCCTACTAG

Protein (221aa)

>JHU11878
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQC
RLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEY
ALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY