Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11862 PCYT1B CCTB Homo sapiens Yes Metabolism

HuProt v2.0
Block Row Column Clone
5 16 9 JHU11862
5 16 10 JHU11862
HuProt v3.0
Block Row Column Clone
14 1 7 JHU11862
14 2 7 JHU11862
HuProt v3.1
Block Row Column Clone
14 1 7 JHU11862
14 2 7 JHU11862

External Database ID

Nucleotide (1110bp)

>JHU11862
ATGCCAGTAGTTACCACTGATGCTGAGTCAGAAACAGGTATCCCAAAATCCCTTTCCAATGAGCCTCCCTCAGAAACCAT
GGAGGAAATAGAGCACACATGCCCACAGCCTCGACTGACCCTGACTGCACCTGCCCCATTTGCTGATGAAACCAACTGCC
AGTGTCAAGCACCCCATGAAAAACTGACCATTGCTCAGGCCCGCTTAGGAACACCAGCTGACAGGCCTGTCAGAGTATAC
GCCGATGGAATATTTGACCTCTTCCACTCAGGTCATGCAAGAGCCCTTATGCAAGCAAAAACACTGTTTCCCAACAGCTA
CTTGTTGGTAGGAGTTTGCAGTGATGATCTCACCCACAAATTCAAAGGTTTCACCGTGATGAATGAAGCCGAGAGATACG
AAGCTCTCAGACACTGTCGCTACGTAGACGAAGTTATCAGAGATGCTCCCTGGACACTCACGCCAGAGTTTCTGGAAAAA
CACAAGATTGACTTTGTGGCTCATGATGACATTCCGTATTCCTCTGCTGGCTCTGATGATGTTTACAAGCACATAAAGGA
AGCAGGGATGTTCGTTCCAACGCAGAGAACAGAAGGCATCTCAACATCGGACATCATTACCAGAATTGTTCGTGACTATG
ATGTTTATGCCCGACGTAACCTCCAGAGAGGGTATACAGCCAAGGAACTGAATGTCAGCTTTATAAATGAGAAGAGGTAC
CGTTTCCAGAACCAAGTGGACAAAATGAAGGAAAAAGTCAAGAATGTGGAGGAAAGATCAAAGGAATTTGTGAACAGAGT
GGAAGAAAAGAGCCATGATCTAATTCAAAAGTGGGAAGAGAAGTCAAGGGAATTCATTGGCAACTTCCTAGAACTGTTTG
GACCTGATGGAGCATGGAAGCAGATGTTCCAGGAGAGGAGCAGCCGGATGCTGCAGGCCTTATCCCCGAAGCAGAGCCCT
GTGAGCAGCCCAACCCGGAGCCGGTCCCCTTCCCGCTCCCCATCGCCCACCTTCTCATGGCTTCCACTCAAAACCTCACC
CCCTTCCTCACCCAAAGCAGCCTCAGCCTCTATCAGCAGCATGAGCGAGGGGGATGAGGATGAAAAGTAG

Protein (369aa)

>JHU11862
MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVY
ADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEK
HKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRY
RFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSP
VSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK