Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11861 PCGF3 RNF3;RNF3A Homo sapiens Yes Nuclear Proteins

HuProt v2.0
Block Row Column Clone
13 16 1 JHU11861
13 16 2 JHU11861
HuProt v3.0
Block Row Column Clone
16 1 13 JHU11861
16 2 13 JHU11861
HuProt v3.1
Block Row Column Clone
16 1 13 JHU11861
16 2 13 JHU11861

External Database ID

Nucleotide (729bp)

>JHU11861
ATGTTGACCAGGAAGATCAAGCTGTGGGACATCAACGCCCACATCACCTGCCGCCTGTGCAGCGGGTACCTCATCGACGC
CACCACGGTGACCGAGTGTCTGCACACCTTCTGCAGGAGCTGCCTGGTGAAGTACCTGGAGGAGAACAACACCTGCCCCA
CCTGCAGGATTGTGATCCACCAGAGCCACCCCCTGCAGTACATCGGTCATGACAGAACCATGCAAGATATTGTTTACAAA
TTGGTACCAGGCCTCCAAGAAGCGGAAATGAGAAAGCAGAGGGAGTTCTATCACAAATTGGGCATGGAGGTGCCGGGAGA
CATCAAGGGGGAGACCTGCTCTGCAAAACAGCACTTAGATTCCCATCGGAATGGTGAAACCAAAGCAGACGACAGTTCAA
ACAAAGAGGCCGCGGAGGAGAAGCCGGAGGAGGACAACGACTACCACCGCAGCGACGAGCAGGTGAGCATCTGCCTGGAG
TGTAACAGCAGCAAACTGCGCGGGCTGAAGCGGAAGTGGATCCGCTGCTCAGCCCAGGCGACCGTCTTGCATCTGAAGAA
GTTCATCGCCAAAAAACTCAACCTTTCATCCTTTAACGAGCTGGACATTTTATGCAACGAGGAGATCCTGGGCAAGGACC
ACACACTCAAGTTCGTGGTTGTCACTAGGTGGAGATTCAAGAAGGCGCCGCTCCTGCTGCACTACAGACCCAAGATGGAC
TTGCTGTAG

Protein (242aa)

>JHU11861
MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVYK
LVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSDEQVSICLE
CNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMD
LL