Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11860 NUBP1 NBP;NBP1 Homo sapiens Yes Nuclear Proteins

HuProt v2.0
Block Row Column Clone
29 16 15 JHU11860
29 16 16 JHU11860
HuProt v3.0
Block Row Column Clone
13 5 13 JHU11860
13 6 13 JHU11860
HuProt v3.1
Block Row Column Clone
13 5 13 JHU11860
13 6 13 JHU11860

External Database ID

Nucleotide (963bp)

>JHU11860
ATGGAGGAGGTGCCTCACGACTGTCCAGGGGCCGACAGCGCCCAGGCGGGCAGAGGGGCTTCATGTCAGGGATGCCCCAA
CCAGCGGCTGTGCGCTTCTGGAGCGGGGGCCACTCCGGACACGGCTATAGAGGAAATCAAAGAGAAAATGAAGACTGTAA
AACACAAAATCTTGGTATTGTCTGGGAAAGGCGGTGTTGGGAAAAGCACATTCAGCGCCCACCTTGCCCATGGCCTAGCA
GAGGATGAAAACACACAGATTGCTCTTCTAGACATCGATATATGTGGGCCATCGATTCCCAAGATAATGGGATTGGAAGG
AGAGCAGGTTCACCAGAGTGGCTCAGGCTGGTCTCCAGTGTACGTGGAAGACAACCTGGGGGTGATGTCAGTGGGCTTCC
TGCTCAGCAGTCCTGATGATGCTGTTATCTGGAGGGGACCCAAGAAAAACGGCATGATCAAGCAGTTCCTCCGAGATGTG
GACTGGGGAGAGGTCGACTACCTCATTGTGGACACCCCACCTGGGACGTCGGATGAACACCTCTCGGTCGTCCGGTACCT
GGCCACAGCACACATCGATGGAGCAGTGATCATCACCACTCCCCAGGAGGTGTCACTCCAGGATGTCCGGAAAGAAATCA
ACTTCTGCCGCAAGGTGAAGCTGCCCATCATCGGGGTGGTGGAGAACATGAGTGGCTTCATCTGTCCTAAGTGCAAGAAA
GAATCTCAGATATTCCCTCCCACAACCGGGGGCGCGGAGCTCATGTGCCAGGACTTGGAGGTCCCTCTCCTCGGCAGAGT
GCCCCTGGATCCGCTCATAGGTAAGAATTGTGACAAAGGCCAGTCTTTTTTCATTGACGCCCCAGATTCCCCAGCCACGT
TAGCCTACAGAAGTATAATTCAGAGAATCCAAGAGTTTTGTAATCTCCATCAGTCAAAAGAAGAGAACCTCATCAGTTCC
TAG

Protein (320aa)

>JHU11860
MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLA
EDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDV
DWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKK
ESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS