Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11835 GTF2E1 TF2E1 Homo sapiens Yes Kinases; Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
7 16 1 JHU11835
7 16 2 JHU11835
HuProt v3.0
Block Row Column Clone
16 1 10 JHU11835
16 2 10 JHU11835
HuProt v3.1
Block Row Column Clone
16 1 10 JHU11835
16 2 10 JHU11835
24 43 17 JHU11835
24 44 17 JHU11835

External Database ID

Nucleotide (1320bp)

>JHU11835
ATGGCAGACCCAGATGTCCTCACTGAAGTTCCAGCAGCATTGAAGCGGTTAGCCAAGTATGTGATCCGGGGATTTTATGG
CATTGAGCATGCCTTGGCCTTGGACATCTTGATCAGGAACTCCTGTGTGAAAGAGGAGGATATGCTGGAGCTGCTCAAGT
TTGATCGGAAGCAACTTCGATCAGTTTTGAATAATTTAAAGGGAGACAAGTTTATCAAATGCAGAATGAGGGTAGAGACT
GCTGCAGACGGGAAAACCACTCGCCATAACTACTACTTCATCAATTATCGTACTCTTGTTAATGTGGTAAAATATAAACT
GGACCACATGAGAAGAAGAATTGAGACCGATGAGAGAGATTCGACCAACCGGGCTTCCTTCAAATGTCCTGTCTGTAGTA
GTACTTTCACAGACTTAGAAGCTAATCAGCTCTTTGATCCTATGACAGGAACTTTCCGCTGTACTTTTTGCCATACAGAG
GTAGAAGAGGATGAATCAGCAATGCCCAAAAAAGATGCACGCACACTTTTGGCAAGGTTTAATGAACAAATTGAGCCCAT
TTATGCATTGCTTCGGGAGACAGAGGATGTGAACTTGGCCTATGAAATACTTGAGCCAGAACCCACAGAAATCCCAGCCC
TGAAACAGAGCAAGGACCATGCAGCAACTACTGCTGGAGCTGCTAGCCTAGCAGGTGGGCACCACCGGGAAGCATGGGCC
ACCAAAGGTCCTTCCTATGAAGACTTATACACTCAGAATGTTGTCATTAACATGGATGACCAAGAAGATCTTCATCGAGC
CTCACTGGAAGGGAAATCTGCCAAAGAGAGGCCTATTTGGTTGAGAGAAAGCACTGTCCAAGGGGCATATGGTTCTGAAG
ATATGAAAGAAGGGGGCATAGATATGGACGCATTTCAGGAGCGTGAGGAAGGCCATGCTGGGCCTGATGACAACGAAGAG
GTCATGCGAGCACTGCTCATTCACGAGAAAAAGACTTCCTCTGCCATGGCTGGTTCAGTGGGGGCAGCTGCTCCAGTGAC
CGCTGCCAATGGCAGTGACTCAGAAAGCGAGACCAGTGAGTCAGATGATGATTCTCCACCCCGTCCGGCAGCTGTGGCTG
TGCATAAACGAGAAGAGGATGAAGAGGAAGATGACGAGTTTGAAGAAGTAGCAGATGACCCCATTGTCATGGTGGCTGGC
CGTCCGTTCTCCTACAGTGAAGTGAGCCAACGGCCAGAGCTAGTGGCCCAGATGACACCAGAAGAAAAGGAAGCATATAT
AGCAATGGGACAACGCATGTTTGAGGACCTCTTTGAGTAG

Protein (439aa)

>JHU11835
MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVET
AADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTE
VEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDHAATTAGAASLAGGHHREAWA
TKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEE
VMRALLIHEKKTSSAMAGSVGAAAPVTAANGSDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAG
RPFSYSEVSQRPELVAQMTPEEKEAYIAMGQRMFEDLFE