Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11819 CDK5RAP3 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
47 16 15 JHU11819
47 16 16 JHU11819
HuProt v3.0
Block Row Column Clone
13 5 28 JHU11819
13 6 28 JHU11819
HuProt v3.1
Block Row Column Clone
13 5 28 JHU11819
13 6 28 JHU11819

External Database ID

Nucleotide (411bp)

>JHU11819
ATGGAGGACCATCAGCACGTGCCCATCGACATCCAGACCAGCAAGCTGCTCGATTGGCTGGTGGACAGAAGGCACTGCAG
CCTGAAATGGCAGAGTCTGGTGCTGACGATCCGCGAGAAGATCAATGCTGCCATCCAGGACATGCCAGAGAGCGAAGAGA
TCGCCCAGCTGCTGTCTGGGTCCTACATTCACTACTTTCACTGCCTAAGAATCCTGGACCTTCTCAAAGGCACAGAGGCC
TCCACGAAGAATATTTTTGGCCGATACTCTTCACAGCGGATGAAGGATTGGCAGGAGATTATAGCTCTGTATGAGAAGGA
CAACACCTACTTAGGTAAAGTGGCCCGGCCTGGGAGCCCTGGTATCCATGGGGAAGCCCACTCTCAGAGTTCTGAGATAC
CAGGCTTATAG

Protein (136aa)

>JHU11819
MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEA
STKNIFGRYSSQRMKDWQEIIALYEKDNTYLGKVARPGSPGIHGEAHSQSSEIPGL