Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11816 C9orf91 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
15 16 1 JHU11816
15 16 2 JHU11816
HuProt v3.0
Block Row Column Clone
16 1 30 JHU11816
16 2 30 JHU11816
HuProt v3.1
Block Row Column Clone
16 1 30 JHU11816
16 2 30 JHU11816

External Database ID

Nucleotide (1029bp)

>JHU11816
ATGGCCTGTGAACCACAGGTGGACCCGGGGGCCACTGGCCCATTGCCCCCCTCCTCCCCTGGCTGGAGTGCCCTGCCTGG
AGGGAGCCCTCCTGGCTGGGGGCAAGAGCTCCACAATGGCCAGGTCCTCACTGTTCTCCGGATTGACAATACCTGTGCAC
CCATCTCCTTCGACCTGGGAGCCGCAGAAGAGCAACTGCAAACTTGGGGCATCCAGGTCCCGGCTGACCAGTACAGGAGC
TTGGCTGAGAGTGCCCTCTTGGAGCCCCAAGTGAGAAGATATATCATCTACAACTCGAGGCCTATGCGGCTGGCCTTTGC
TGTGGTTTTCTATGTGGTGGTGTGGGCCAATATCTACTCTACCAGTCAGATGTTTGCCTTGGGGAACCACTGGGCTGGCA
TGCTGCTCGTGACCCTGGCCGCGGTGAGCCTGACCTTGACTCTTGTGCTGGTCTTTGAAAGACACCAGAAGAAGGCCAAC
ACCAACACGGACCTGAGGCTGGCAGCTGCCAATGGAGCCCTCCTGAGACACCGGGTGCTGCTGGGGGTGACAGACACAGT
GGAAGGATGCCAGAGTGTGATTCAGCTTTGGTTTGTCTACTTCGACCTGGAGAACTGTGTGCAGTTTTTGTCTGATCATG
TTCAAGAAATGAAGACTAGCCAAGAGTCCTTGCTGAGAAGCAGATTGAGCCAGTTGTGTGTTGTCATGGAGACTGGGGTG
AGCCCTGCAACAGCGGAGGGGCCTGAGAACTTGGAGGATGCTCCTCTCCTGCCCGGCAATTCTTGTCCTAACGAGAGGCC
ACTCATGCAGACTGAGCTTCATCAGCTTGTTCCTGAGGCTGAGCCGGAGGAAATGGCCCGCCAGCTGCTGGCAGTGTTTG
GCGGCTACTACATCCGGCTTCTAGTGACCTCCCAGCTCCCTCAGGCAATGGGGACACGACACACGAACTCTCCGAGAATT
CCATGCCCCTGCCAGCTCATAGAAGCCTACATCCTAGGCACAGGGTGCTGCCCGTTCCTGGCGAGGTAG

Protein (342aa)

>JHU11816
MACEPQVDPGATGPLPPSSPGWSALPGGSPPGWGQELHNGQVLTVLRIDNTCAPISFDLGAAEEQLQTWGIQVPADQYRS
LAESALLEPQVRRYIIYNSRPMRLAFAVVFYVVVWANIYSTSQMFALGNHWAGMLLVTLAAVSLTLTLVLVFERHQKKAN
TNTDLRLAAANGALLRHRVLLGVTDTVEGCQSVIQLWFVYFDLENCVQFLSDHVQEMKTSQESLLRSRLSQLCVVMETGV
SPATAEGPENLEDAPLLPGNSCPNERPLMQTELHQLVPEAEPEEMARQLLAVFGGYYIRLLVTSQLPQAMGTRHTNSPRI
PCPCQLIEAYILGTGCCPFLAR