Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11815 C17orf58 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
39 16 15 JHU11815
39 16 16 JHU11815
HuProt v3.0
Block Row Column Clone
13 5 18 JHU11815
13 6 18 JHU11815
HuProt v3.1
Block Row Column Clone
13 5 18 JHU11815
13 6 18 JHU11815

External Database ID

Nucleotide (228bp)

>JHU11815
ATGAACCGCCTGTACCTCACCCCCGACGGCTTCTTCTTCCGAGTCCACATGTTAGCCCTGGACTCCTCCAGCTGCAATAA
GCCGTGTCCAGAGTTTAAACCTGGTATTGAAACTGACCTGAATGACGCTGCATATGTACTTTATACCACCGTTTGTAACG
TGGGTGCCACAGCCCGGGCTGTAGGTCGCCCAGCCTTTTTTTGGGAGCGATGGGGAACAATGACATAG

Protein (75aa)

>JHU11815
MNRLYLTPDGFFFRVHMLALDSSSCNKPCPEFKPGIETDLNDAAYVLYTTVCNVGATARAVGRPAFFWERWGTMT