Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11801 ZNF528 KIAA1827 Homo sapiens Yes Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
17 16 15 JHU11801
17 16 16 JHU11801
4 29 15 JHU11801
4 29 16 JHU11801
HuProt v3.0
Block Row Column Clone
13 5 1 JHU11801
13 6 1 JHU11801
21 39 20 JHU11801
21 40 20 JHU11801
HuProt v3.1
Block Row Column Clone
13 5 1 JHU11801
13 6 1 JHU11801
21 39 20 JHU11801
21 40 20 JHU11801

External Database ID

Nucleotide (1887bp)

>JHU11801
ATGGCCCTTACTCAGGGACCCTTGAAATTCATGGATGTGGCCATAGAGTTCTCTCAGGAAGAGTGGAAATGCCTGGACCC
TGCGCAGAGGACTTTATACAGGGACGTGATGTTGGAGAATTATAGGAACCTGGTCTCCCTGGGAATCTGTCTTCCTGACC
TGAGTGTTACCTCCATGTTAGAGCAAAAGAGAGATCCCTGGACTCTGCAGAGTGAAGAGAAAATAGCAAACGATCCAGAC
GGCAGGGAGTGCATCAAAGGTGTGAACACAGAGAGGAGCTCTAAATTGGGAAGTAATGCAGGAAACAAGCCTTGTAAAAA
TCAACTTGGATTCACTTTTCAGTTACATCTGAGTGATCTACAGCTATTTCAAGCTGAAAGGAAAATTTCTGGGTGTAAGC
ATTTTGAAAAACCCGTCAGTGACAATTCCTCAGTTTCACCGCTTGAAAAAATTTCTTCCAGTGTCAAATCCCACCTTTTA
AATAAATATAGAAATAATTTTGATCATGCTCCATTACTTCCACAAGAACAGAAAGCACACATTAGGGAAAAAGCTTATAA
ATGTAATGAGCACGGCCAAGTCTTTAGAGCATCTGCAAGCCTTACTAACCAAGTAATCCATAACGCAGATAATCCTTACA
AATGCAGTGAATGTGGCAAGGTCTTTAGTTGCAGTTCAAAGCTTGTGATACATCGAAGAATGCATACTGGAGAGAAGCCT
TACAAATGTCATGAATGTGGCAAGCTCTTCAGTAGCAATTCAAACCTTTCACAACATCAAAGAATTCATACTGGAGAGAA
GCCTTACAAATGTCATGAATGTGACAAAGTCTTTCGAAGCAGTTCAAAGCTTGCACAACATCAAAGAATTCATACTGGAG
AGAAGCCTTACAAATGTCATGAATGTGACAAGGTCTTCAATCAAATTGCACACCTTGTACGACATCAAAAAATTCATACT
GGAGAGAAACCTTACAGTTGTAATAAATGTGGCAAGGTCTTTAGTCGCCATTCATATCTAGCAGAACATCAAACGGTTCA
TACTGGTGAGAAACCTTACAAATGTGAAGAATGTGGCAAAGCATTTTCAGTGCGTTCCAGCCTCATAACCCATCAGTTAA
TTCACACTGGAAGGAAACCTTACAAATGTAAAGAATGTGACAAGGTCTTTGGGCGCAAGTGTTTCCTGACCTCTCATCAG
AGAATTCATACTAGAGAGAGACCTTATGGATGCAGTCAGTGTGGCAAGATCTTTAGTCAGAAATCAGACCTTATACGACA
TCGAAAAACTCATACTGATGAGAAGCCTTACAAATGTAATAAATGTGGCACAGCGTTTAGAGAGTTTTCAGACCTTACTG
CCCATTTTCTAATCCATAGTGGAGAGAAACCTTATGAATGTAAAGAATGTGGCAAAGTCTTCAGGTACAAGTCTTCTCTA
ACCAGTCATCATAGAATTCATACTGGAGAGAAGCCTTACAAATGTAACAGATGTGGCAAGGTCTTCAGTCGCAGTTCAAA
CCTGGTATGCCATCAGAAAATTCATACAGGAGAAAAGCCTTACAAATGTAATCAATGTGGCAAGGTCTTTAATCAAGCAT
CATACCTTACAAGACATCAAATAATTCATACTGGAGAGAGGCCTTACAGATGTAGTAAATGTGGCAAAGCATTTCGAGGG
TGTTCAGGCCTTACTGCCCATCTTGCAATCCATACTGAAAAGAAATCTCATGAGTGTAAAGAATGTGGCAAGATCTTCAC
TCAGAAGTCTTCCCTCACCAATCACCATAGAATTCACATTGGAGAGAAACCTTACAAATGCACCCTGTGCAGTAAGGTCT
TCAGTCACAATTCTGACCTTGCACAGCATCAGAGAGTTCATTCATAG

Protein (628aa)

>JHU11801
MALTQGPLKFMDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLGICLPDLSVTSMLEQKRDPWTLQSEEKIANDPD
GRECIKGVNTERSSKLGSNAGNKPCKNQLGFTFQLHLSDLQLFQAERKISGCKHFEKPVSDNSSVSPLEKISSSVKSHLL
NKYRNNFDHAPLLPQEQKAHIREKAYKCNEHGQVFRASASLTNQVIHNADNPYKCSECGKVFSCSSKLVIHRRMHTGEKP
YKCHECGKLFSSNSNLSQHQRIHTGEKPYKCHECDKVFRSSSKLAQHQRIHTGEKPYKCHECDKVFNQIAHLVRHQKIHT
GEKPYSCNKCGKVFSRHSYLAEHQTVHTGEKPYKCEECGKAFSVRSSLITHQLIHTGRKPYKCKECDKVFGRKCFLTSHQ
RIHTRERPYGCSQCGKIFSQKSDLIRHRKTHTDEKPYKCNKCGTAFREFSDLTAHFLIHSGEKPYECKECGKVFRYKSSL
TSHHRIHTGEKPYKCNRCGKVFSRSSNLVCHQKIHTGEKPYKCNQCGKVFNQASYLTRHQIIHTGERPYRCSKCGKAFRG
CSGLTAHLAIHTEKKSHECKECGKIFTQKSSLTNHHRIHIGEKPYKCTLCSKVFSHNSDLAQHQRVHS