Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11799 ZNF512B KIAA1196 Homo sapiens Yes Nuclear Proteins

HuProt v2.0
Block Row Column Clone
17 16 9 JHU11799
17 16 10 JHU11799
HuProt v3.0
Block Row Column Clone
14 1 19 JHU11799
14 2 19 JHU11799
HuProt v3.1
Block Row Column Clone
14 1 19 JHU11799
14 2 19 JHU11799

External Database ID

Nucleotide (2679bp)

>JHU11799
ATGACGGATCCTTTCTGCGTTGGAGGCCGTCGGCTCCCGGGGTCCAGCAAGAGTGGTCCCGGGAAGGATGGCAGCCGAAA
GGAGGTCCGACTTCCAATGCTGCATGACCCACCGAAGATGGGGATGCCGGTGGTCCGTGGTGGACAGACAGTGCCCGGCC
AGGCCCCTCTCTGCTTTGACCCGGGAAGTCCAGCCAGTGACAAGACAGAAGGGAAGAAAAAGGGGCGGCCAAAAGCCGAG
AACCAGGCCCTCCGAGACATTCCTCTCTCCCTGATGAACGACTGGAAGGATGAGTTCAAGGCACACTCGAGGGTGAAGTG
TCCAAACTCAGGGTGCTGGCTGGAGTTCCCCAGCATCTACGGGCTCAAGTACCATTACCAGCGGTGCCAAGGGGGTGCCA
TCTCAGATCGCCTGGCCTTCCCCTGCCCCTTCTGCGAGGCCGCATTCACCTCTAAGACCCAGCTGGAGAAACACCGGATC
TGGAACCACATGGACCGACCCCTGCCTGCCTCCAAGCCTGGGCCCATCAGCAGGCCGGTCACCATCAGCCGGCCTGTTGG
GGTCAGCAAGCCCATCGGAGTGAGCAAACCTGTCACTATTGGCAAACCTGTGGGTGTCAGCAAACCCATTGGCATCAGCA
AGCCAGTCTCGGTCGGCAGACCCATGCCAGTCACCAAGGCCATCCCGGTCACTAGGCCCGTGCCAGTCACCAAACCTGTC
ACAGTCAGCAGGCCCATGCCCGTCACCAAGGCCATGCCGGTCACCAAACCCATCACAGTCACCAAGTCTGTGCCGGTCAC
CAAACCCGTACCTGTCACCAAACCCATTACGGTAACAAAGCTTGTGACAGTTACGAAACCCGTGCCGGTCACCAAGCCAG
TGACAGTCAGCAGGCCCATTGTGGTCAGCAAGCCGGTGACAGTCAGCAGGCCCATTGCTATCAGCAGACACACACCGCCC
TGCAAAATGGTGCTGCTGACCAGGTCGGAGAACAAAGCACCTCGTGCCACAGGGAGGAACAGTGGTAAGAAAAGGGCTGC
GGACAGCCTGGACACCTGCCCAATTCCACCCAAGCAGGCCAGGCCAGAGAATGGGGAGTACGGCCCCTCCTCCATGGGCC
AGAGCTCGGCCTTCCAGCTGAGTGCAGACACCAGCAGTGGCTCCTTGTCGCCAGGCAGCAGGCCGTCAGGGGGCATGGAG
GCACTGAAGGCTGCAGGCCCTGCGTCCCCGCCTGAGGAGGACCCGGAGCGCACAAAGCACAGAAGGAAACAGAAAACACC
CAAAAAGTTTACAGGGGAGCAGCCATCCATCTCAGGGACCTTTGGGCTCAAAGGCCTGGTCAAAGCTGAGGACAAGGCCC
GAGTTCACCGCTCCAAGAAGCAGGAGGGGCCAGGCCCTGAGGACGCCCGGAAGAAGGTGCCAGCTGCCCCCATCACTGTC
AGCAAGGAGGCACCGGCCCCTGTGGCCCACCCAGCTCCAGGTGGCCCTGAAGAGCAGTGGCAGAGGGCCATCCATGAGCG
CGGGGAAGCCGTCTGCCCCACCTGCAACGTGGTCACCCGGAAGACTCTCGTGGGGCTTAAGAAGCACATGGAGGTGTGTC
AGAAGCTTCAGGATGCACTCAAGTGCCAGCACTGCCGGAAGCAGTTCAAGTCCAAAGCCGGCCTCAACTACCACACTATG
GCCGAGCACAGTGCCAAGCCCTCTGACGCCGAGGCCTCCGAAGGGGGCGAGCAGGAGGAGCGCGAGAGGCTGCGCAAGGT
GCTGAAGCAGATGGGACGGCTGCGCTGCCCCCAGGAGGGTTGCGGGGCTGCCTTCTCCAGCCTCATGGGCTACCAGTACC
ACCAGCGGCGCTGCGGGAAGCCGCCCTGCGAGGTGGACAGCCCCTCCTTCCCCTGCACCCACTGTGGCAAGACGTACCGA
TCCAAGGCTGGCCACGACTACCACGTGCGCTCGGAGCACACGGCCCCCCCCCCTGAGGAGCCCACAGACAAGTCCCCTGA
GGCTGAGGACCCGCTGGGTGTGGAGCGGACCCCAAGCGGGCGTGTCCGCCGCACGTCGGCCCAGGTGGCGGTGTTCCACC
TGCAGGAGATAGCGGAGGACGAGCTGGCCCGCGACTGGACCAAGCGGCGCATGAAGGATGACCTTGTGCCCGAGACCGCA
CGGCTCAACTACACTCGACCAGGGCTCCCCACGCTGAACCCCCAGCTGCTAGAGGCATGGAAGAATGAAGTGAAGGAGAA
AGGCCACGTCAACTGTCCCAACGACTGCTGTGAAGCCATCTACTCCAGCGTGTCCGGACTCAAGGCTCATCTCGCCAGCT
GCAGTAAGGGGGCCCACCTGGCAGGGAAGTACCGCTGTCTGCTGTGTCCGAAGGAGTTCAGTTCTGAGAGTGGCGTCAAA
TACCACATCCTGAAGACCCACGCAGAGAACTGGTTCCGAACATCAGCAGACCCACCTCCCAAACACAGGAGCCAGGACTC
ATTGGTGCCCAAGAAGGAAAAGAAGAAAAATCTGGCAGGTGGAAAGAAGCGGGGCCGAAAGCCCAAGGAGCGGACCCCAG
AGGAGCCTGTGGCCAAGCTGCCCCCGCGCCGGGACGACTGGCCTCCAGGATGCAGAGACAAGGGGGCCCGGGGCTCCACC
GGCCGGAAGGTGGGAGTCAGCAAGGCGCCTGAAAAGTAG

Protein (892aa)

>JHU11799
MTDPFCVGGRRLPGSSKSGPGKDGSRKEVRLPMLHDPPKMGMPVVRGGQTVPGQAPLCFDPGSPASDKTEGKKKGRPKAE
NQALRDIPLSLMNDWKDEFKAHSRVKCPNSGCWLEFPSIYGLKYHYQRCQGGAISDRLAFPCPFCEAAFTSKTQLEKHRI
WNHMDRPLPASKPGPISRPVTISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVSVGRPMPVTKAIPVTRPVPVTKPV
TVSRPMPVTKAMPVTKPITVTKSVPVTKPVPVTKPITVTKLVTVTKPVPVTKPVTVSRPIVVSKPVTVSRPIAISRHTPP
CKMVLLTRSENKAPRATGRNSGKKRAADSLDTCPIPPKQARPENGEYGPSSMGQSSAFQLSADTSSGSLSPGSRPSGGME
ALKAAGPASPPEEDPERTKHRRKQKTPKKFTGEQPSISGTFGLKGLVKAEDKARVHRSKKQEGPGPEDARKKVPAAPITV
SKEAPAPVAHPAPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQKLQDALKCQHCRKQFKSKAGLNYHTM
AEHSAKPSDAEASEGGEQEERERLRKVLKQMGRLRCPQEGCGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCTHCGKTYR
SKAGHDYHVRSEHTAPPPEEPTDKSPEAEDPLGVERTPSGRVRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETA
RLNYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCSKGAHLAGKYRCLLCPKEFSSESGVK
YHILKTHAENWFRTSADPPPKHRSQDSLVPKKEKKKNLAGGKKRGRKPKERTPEEPVAKLPPRRDDWPPGCRDKGARGST
GRKVGVSKAPEK