Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00118 CXCL10 INP10;SCYB10 Homo sapiens Yes Kinases; Secreted Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
24 1 5 JHU00118
24 1 6 JHU00118
HuProt v3.0
Block Row Column Clone
3 1 22 JHU00118
3 2 22 JHU00118
HuProt v3.1
Block Row Column Clone
3 1 22 JHU00118
3 2 22 JHU00118

External Database ID

Nucleotide (297bp)

>JHU00118
ATGAATCAAACTGCCATTCTGATTTGCTGCCTTATCTTTCTGACTCTAAGTGGCATTCAAGGAGTACCTCTCTCTAGAAC
TGTACGCTGTACCTGCATCAGCATTAGTAATCAACCTGTTAATCCAAGGTCTTTAGAAAAACTTGAAATTATTCCTGCAA
GCCAATTTTGTCCACGTGTTGAGATCATTGCTACAATGAAAAAGAAGGGTGAGAAGAGATGTCTGAATCCAGAATCGAAG
GCCATCAAGAATTTACTGAAAGCAGTTAGCAAGGAAAGGTCTAAAAGATCTCCTTAG

Protein (98aa)

>JHU00118
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESK
AIKNLLKAVSKERSKRSP