Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11784 STS ARSC1 Homo sapiens Yes Metabolism

HuProt v2.0
Block Row Column Clone
3 16 1 JHU11784
3 16 2 JHU11784
HuProt v3.0
Block Row Column Clone
16 1 6 JHU11784
16 2 6 JHU11784
HuProt v3.1
Block Row Column Clone
16 1 6 JHU11784
16 2 6 JHU11784

External Database ID

Nucleotide (1752bp)

>JHU11784
ATGCCTTTAAGGAAGATGAAGATCCCTTTCCTCCTACTGTTCTTTCTGTGGGAAGCCGAGAGCCACGCAGCATCAAGGCC
GAACATCATCCTGGTGATGGCTGACGACCTCGGCATTGGAGATCCTGGGTGCTATGGGAACAAAACTATCAGGACTCCCA
ATATCGACCGGTTGGCCAGTGGGGGAGTGAAACTCACTCAGCACCTGGCAGCATCACCGCTGTGCACACCAAGCAGGGCA
GCCTTCATGACTGGCCGGTACCCTGTCCGATCAGGAATGGCATCTTGGTCCCGCACTGGAGTTTTCCTCTTCACAGCCTC
TTCGGGAGGACTTCCCACCGATGAGATTACCTTTGCTAAGCTTCTGAAGGATCAAGGTTATTCAACAGCACTGATAGGGA
AATGGCACCTTGGGATGAGCTGTCACAGCAAGACTGACTTCTGTCACCACCCTTTACATCACGGCTTCAATTATTTCTAT
GGGATCTCTTTGACCAATCTGAGAGACTGCAAGCCCGGAGAGGGCAGTGTCTTCACCACGGGCTTCAAGAGGCTGGTCTT
CCTCCCCCTGCAGATCGTCGGGGTCACCCTCCTTACCCTTGCTGCACTCAATTGTCTGGGGCTACTCCACGTGCCTCTAG
GCGTTTTTTTCAGCCTTCTCTTCCTAGCAGCCCTAATCCTGACCCTTTTCTTGGGCTTCCTTCATTACTTCCGGCCCCTG
AACTGCTTCATGATGAGGAACTACGAGATCATTCAGCAGCCCATGTCCTATGACAATCTCACCCAGAGGCTAACGGTGGA
GGCGGCCCAGTTCATACAGCGGAACACTGAGACTCCGTTCCTGCTTGTCTTGTCCTACCTCCACGTGCACACAGCCCTGT
TCTCCAGCAAAGACTTTGCTGGCAAAAGTCAACACGGAGTCTACGGGGATGCTGTTGAGGAAATGGACTGGAGTGTGGGG
CAGATCTTGAACCTTCTGGATGAGCTGAGATTGGCTAATGATACCCTCATCTACTTCACATCGGACCAGGGAGCACATGT
AGAAGAAGTGTCTTCCAAAGGAGAAATTCATGGCGGAAGTAATGGGATCTATAAAGGAGGAAAAGCAAACAACTGGGAAG
GAGGTATCCGGGTTCCAGGCATCCTTCGTTGGCCCAGGGTGATACAGGCTGGCCAGAAGATTGATGAGCCCACTAGCAAC
ATGGACATATTTCCTACAGTAGCCAAGCTGGCTGGAGCTCCCTTGCCTGAGGACAGGATCATTGATGGACGTGATCTGAT
GCCCCTGCTTGAAGGAAAAAGCCAACGCTCCGATCATGAGTTTCTCTTCCATTACTGCAACGCCTACTTAAATGCTGTGC
GCTGGCACCCTCAGAACAGCACATCCATCTGGAAGGCCTTTTTCTTCACCCCCAACTTCAACCCCGTGGGTTCCAACGGA
TGCTTTGCCACACACGTGTGCTTCTGTTTCGGGAGTTATGTCACCCATCACGACCCACCTTTACTCTTTGATATTTCCAA
AGATCCCAGAGAGAGAAACCCACTAACTCCAGCATCCGAGCCCCGGTTTTATGAAATCCTCAAAGTCATGCAGGAAGCTG
CGGACAGACACACCCAGACCCTGCCAGAGGTGCCCGATCAGTTTTCATGGAACAACTTTCTTTGGAAGCCCTGGCTTCAG
CTGTGCTGTCCTTCCACCGGCCTGTCTTGCCAGTGTGATAGAGAAAAACAGGATAAGAGACTGAGCCGCTAG

Protein (583aa)

>JHU11784
MPLRKMKIPFLLLFFLWEAESHAASRPNIILVMADDLGIGDPGCYGNKTIRTPNIDRLASGGVKLTQHLAASPLCTPSRA
AFMTGRYPVRSGMASWSRTGVFLFTASSGGLPTDEITFAKLLKDQGYSTALIGKWHLGMSCHSKTDFCHHPLHHGFNYFY
GISLTNLRDCKPGEGSVFTTGFKRLVFLPLQIVGVTLLTLAALNCLGLLHVPLGVFFSLLFLAALILTLFLGFLHYFRPL
NCFMMRNYEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVG
QILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIYKGGKANNWEGGIRVPGILRWPRVIQAGQKIDEPTSN
MDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHYCNAYLNAVRWHPQNSTSIWKAFFFTPNFNPVGSNG
CFATHVCFCFGSYVTHHDPPLLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSWNNFLWKPWLQ
LCCPSTGLSCQCDREKQDKRLSR