Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11772 PRAP1 UPA Homo sapiens Yes Secreted Proteins

HuProt v2.0
Block Row Column Clone
33 16 15 JHU11772
33 16 16 JHU11772
HuProt v3.0
Block Row Column Clone
13 5 19 JHU11772
13 6 19 JHU11772
HuProt v3.1
Block Row Column Clone
13 5 19 JHU11772
13 6 19 JHU11772

External Database ID

Nucleotide (456bp)

>JHU11772
ATGAGGAGGCTCCTCCTGGTCACCAGCCTGGTGGTTGTGCTGCTGTGGGAGGCAGGTGCAGTCCCAGCACCCAAGGTCCC
TATCAAGATGCAAGTCAAACACTGGCCCTCAGAGCAGGACCCAGAGAAGGCCTGGGGCGCCCGTGTGGTGGAGCCTCCGG
AGAAGGACGACCAGCTGGTGGTGCTGTTCCCTGTCCAGAAGCCGAAACTCTTGACCACCGAGGAGAAGCCACGAGGTCAG
GGCAGGGGCCCCATCCTTCCAGGCACCAAGGCCTGGATGGAGACCGAGGACACCCTGGGCCGTGTCCTGAGTCCCGAGCC
CGACCATGACAGCCTGTACCACCCTCCGCCTGAGGAGGACCAGGGCGAGGAGAGGCCCCGGTTGTGGGTGATGCCAAATC
ACCAGGTGCTCCTGGGACCGGAGGAAGACCAAGACCACATCTACCACCCCCAGTAG

Protein (151aa)

>JHU11772
MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQ
GRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ