Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11771 PPT2 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
25 16 15 JHU11771
25 16 16 JHU11771
HuProt v3.0
Block Row Column Clone
13 5 11 JHU11771
13 6 11 JHU11771
HuProt v3.1
Block Row Column Clone
13 5 11 JHU11771
13 6 11 JHU11771

External Database ID

Nucleotide (927bp)

>JHU11771
ATGAAGAGTTGCGGGAGCATGCTGGGGCTCTGGGGGCAGCGGCTCCCCGCGGCGTGGGTCCTGCTTCTGTTGCCTTTCCT
GCCGCTGCTGCTGCTTGCAGCCCCCGCGCCCCACCGCGCGTCCTACAAGCCGGTCATCGTGGTGCATGGGCTCTTCGACA
GCTCGTACAGCTTCCGCCACCTGCTGGAATACATCAATGAGACACACCCCGGGACTGTGGTGACAGTGCTCGATCTCTTC
GATGGGAGAGAGAGCTTGCGACCCCTGTGGGAACAGGTGCAAGGGTTCCGAGAGGCTGTGGTCCCCATCATGGCAAAGGC
CCCTCAAGGGGTGCATCTCATCTGCTACTCGCAGGGGGGCCTTGTGTGCCGGGCTCTGCTTTCTGTCATGGATGATCACA
ACGTGGATTCTTTCATCTCCCTCTCCTCTCCACAGATGGGACAGTATGGAGACACGGACTACTTGAAGTGGCTGTTCCCC
ACCTCCATGCGGTCTAACCTCTATCGGATCTGCTATAGCCCCTGGGGCCAGGAATTCTCCATCTGCAACTACTGGCATGA
TCCCCACCACGATGACTTGTACCTCAATGCCAGCAGCTTCCTGGCCCTGATCAATGGGGAAAGAGACCATCCCAATGCCA
CAGTATGGCGGAAGAACTTTCTGCGTGTGGGCCACCTGGTGCTGATTGGGGGCCCTGATGATGGTGTTATTACTCCCTGG
CAGTCCAGCTTCTTTGGTTTCTATGATGCAAATGAGACCGTCCTGGAGATGGAGGAGCAACTGGTTTATCTGCGGGATTC
TTTTGGGTTGAAGACTCTATTGGCCCGGGGGGCCATAGTGAGGTGTCCAATGGCCGGTATCTCCCACACAGCCTGGCACT
CCAACCGTACCCTTTATGAGACCTGCATTGAACCTTGGCTCTCCTAG

Protein (308aa)

>JHU11771
MKSCGSMLGLWGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRHLLEYINETHPGTVVTVLDLF
DGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGGLVCRALLSVMDDHNVDSFISLSSPQMGQYGDTDYLKWLFP
TSMRSNLYRICYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPW
QSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS