Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11765 PCDHAC2 Homo sapiens Yes Membrane Proteins

HuProt v2.0
Block Row Column Clone
25 16 5 JHU11765
25 16 6 JHU11765
HuProt v3.0
Block Row Column Clone
15 1 25 JHU11765
15 2 25 JHU11765
HuProt v3.1
Block Row Column Clone
15 1 25 JHU11765
15 2 25 JHU11765

External Database ID

Nucleotide (2655bp)

>JHU11765
ATGGAGCAGGCGGGCACCAGACCTGCGGCGACAGAGCATCCACGGCTCCGGCGGCCCATGCCCTGGCTGCTGCTACTGCC
TCTCCTGCTGCTGTTGCTGCTGCTGCTACCTGGCCCAGCGGCCTCCCAGCTGCGATACTCTGTGCCAGAGGAGCAGGCAC
CCGGCGCGCTCGTGGGCAACGTGGCTCGCGCGCTGGGGCTTGAGCTGCGGCGCTTGGGGCCGGGTTGCTTGCGCATCAAC
CATCTGGGTGCGCCCAGTCCGCGCTACCTGGAGCTGGACCTGACGAGTGGAGCGCTCTTCGTCAACGAGCGCATTGATCG
GGAGGCGCTGTGTGAGCAGCGGCCTCGCTGCCTGCTCAGCCTGGAAGTGCTGGCGCACAACCCCGTGGCGGTGAGCGCCG
TTGAGGTGGAAATATTGGACATCAACGACAACTCACCGCGTTTCCCGCGGCCCAACTACCAGCTTCAGGTAAGCGAATCG
GTGGCGCCTGGAGCGCGCTTTCACATAGAGAGTGCGCAGGACCCCGACGTGGGCGCCAACTCAGTACAGACCTACGAGCT
CAGCCCCAGCGAGCACTTCGAGCTGGACCTTAAGCCCCTGCAGGAGAACAGTAAAGTGCTTGAGCTGGTGCTGCGTAAGG
GCCTAGACCGGGAGCAGGCAGCCTTGCACCACCTGGTTCTCACAGCCGTGGATGGGGGCATTCCAGCCCGCTCGGGTACG
GCACAGATCTCTGTGCGTGTCCTGGACACTAACGACAACTCTCCTGCCTTTGACCAGTCCACTTATCGCGTCCAGCTACG
GGAGGACTCACCCCCAGGCACATTGGTGGTGAAGCTGAATGCCTCAGACCCGGATGAGGGCTCCAATGGTGAGCTCAGGT
ACTCCTTGAGCAGCTACACGTCGGACCGGGAGAGGCAGCTCTTCAGCATAGATGCCAGTACCGGGGAAGTGCGAGTAATT
GGGGGGCTGGATTATGAGGAAGCCTCCTCCTACCAGATCTATGTGCAGGCGACTGACCGGGGTCCAGTGCCCATGGCAGG
TCACTGCAAGGTGCTGGTGGACATCGTGGACGTGAATGACAATGCCCCAGAGGTGGTGCTCACGGACCTGTATAGCCCAG
TGCCTGAGAATGCTACACCCAACACCATTGTGGCCGTTCTCAGTGTCAATGACCAAGACTCAGGCCCCAACCGGAAAGTG
AGCCTGGGTCTGGAGGCCACACTGCCTTTCCGACTGAATGGCTTTGGAAACTCCTATACACTGGTGGTGAGCGGCCCACT
GGACCGAGAGCGGGTGGCTGTCTACAACATCACGGTGACAGCCACAGATGGGGGAATACCGCAGCTCACATCCCTGCGTA
CACTGAAGGTTGAGATCTCTGACATCAATGACAATCCACCAAGCTTCCTGGAGGACTCCTATTCCATCTACATACAGGAG
AACAATTTGCCAGGTGTGTTGCTCTGTACTGTGCAAGCCACAGACCCAGATGAAAAGGAGAATGCAGAGGTGACCTACTC
CCTTCTGGAGAGGGAGATTCAAGGGCTGCCAGTCACCTCCTATGTCTCCATTAACAGTGCCAGTGGCAGCCTTTATGCTG
TCAACTCCTTTGACTATGAGAAGTTTCGGGAGTTCTTTGTGACTGTGGAGGCTCAGGACAAGGGGAGCCCACCACTGAGC
AGCACTGTGACTGCCAACGTATATGTGGTGGACATGAATGACCATGCCCCTCACATTCTGTACCCTACCTCAACCAACTC
GTCAGCAGCCTTCGAGATGGTGCCTCGAACTGCCCCTGCTGGCTACCTGGTCACCAAAGTCATAGCTATGGACTCAGACT
CTGGGCAAAATGCTTGGCTTTTTTACCATCTAGCCCAGACTTCTGACCTGGACCTCTTTAAGGTAGAGCTGCACACAGGA
GAAATTAGGACTACCAGGAAGATGGGAGATGAGAGTGGTAGCACTTTCAACCTGACCGTGGTGGTCCGAGATAATGGAGA
GCCATCACTATCAGCCTCTGTGGCCATTACAGTAGCTGTGGTGGATAGGGTTTCCAAAATCCTCCCTGACACTCAGAGGC
ATGTTAAGAGCCCTCGGACATACTCTGAAATTACCCTTTATCTAATAATAGCATTAAGCACAGTGTCTTTTATATTTCTT
TTGACAATCATCATTTTGAGCATCATCAAGTGCTACCGCTACACTGCGTATGGCACTGCATGCTGTGGAGGCTTCTGTGG
AGTAAGGGAAAGGTCCCCTGCAGAACTGTACAAACAAGCCAACAACAATATTGATGCCAGGATACCGCATGGCCTCAAAG
TGCAGCCTCACTTCATTGAAGTTCGAGGGAATGGCTCCCTCACCAAGACCTACTGCTACAAGGCCTGTCTGACAGCAGGC
TCAGGGAGTGACACTTTCATGTTTTACAATACAGGGGCCCAGACAGGACCAGGGCCTTCGGGAGCCCAAGCAGCAGTGAC
TGACAGCAGGAATCTCACAGGCCAAAGTGGTCAGAATGCTGGGAACCTGATTATTCTCAAAAATGAGGCTGTTTCTCAAA
ATGAGGTGAGACAGTGGTCAGGGGGTCTTCTACAAACTCATGCATTTGTTACACATCCCCCAATATCCTGTGATTTGGCT
TTATTGAGTCATTAG

Protein (884aa)

>JHU11765
MEQAGTRPAATEHPRLRRPMPWLLLLPLLLLLLLLLPGPAASQLRYSVPEEQAPGALVGNVARALGLELRRLGPGCLRIN
HLGAPSPRYLELDLTSGALFVNERIDREALCEQRPRCLLSLEVLAHNPVAVSAVEVEILDINDNSPRFPRPNYQLQVSES
VAPGARFHIESAQDPDVGANSVQTYELSPSEHFELDLKPLQENSKVLELVLRKGLDREQAALHHLVLTAVDGGIPARSGT
AQISVRVLDTNDNSPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDASTGEVRVI
GGLDYEEASSYQIYVQATDRGPVPMAGHCKVLVDIVDVNDNAPEVVLTDLYSPVPENATPNTIVAVLSVNDQDSGPNRKV
SLGLEATLPFRLNGFGNSYTLVVSGPLDRERVAVYNITVTATDGGIPQLTSLRTLKVEISDINDNPPSFLEDSYSIYIQE
NNLPGVLLCTVQATDPDEKENAEVTYSLLEREIQGLPVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGSPPLS
STVTANVYVVDMNDHAPHILYPTSTNSSAAFEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLAQTSDLDLFKVELHTG
EIRTTRKMGDESGSTFNLTVVVRDNGEPSLSASVAITVAVVDRVSKILPDTQRHVKSPRTYSEITLYLIIALSTVSFIFL
LTIIILSIIKCYRYTAYGTACCGGFCGVRERSPAELYKQANNNIDARIPHGLKVQPHFIEVRGNGSLTKTYCYKACLTAG
SGSDTFMFYNTGAQTGPGPSGAQAAVTDSRNLTGQSGQNAGNLIILKNEAVSQNEVRQWSGGLLQTHAFVTHPPISCDLA
LLSH