Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11761 MUM1 EXPAND1 Homo sapiens Yes Nuclear Proteins

HuProt v2.0
Block Row Column Clone
9 16 9 JHU11761
9 16 10 JHU11761
HuProt v3.0
Block Row Column Clone
14 1 11 JHU11761
14 2 11 JHU11761
HuProt v3.1
Block Row Column Clone
14 1 11 JHU11761
14 2 11 JHU11761

External Database ID

Nucleotide (2136bp)

>JHU11761
ATGATGGCGGATGCCAAGTATGTCCTCTGCCGATGGGAAAAGCGATTATGGCCTGCGAAGGTTTTGGCCCGAACCGCGAC
TTCAACAAAAAATAAGAGAAGAAAGGAATATTTTCTAGCTGTGCAAATCCTCTCTCTAGAGGAAAAAATTAAGGTGAAAA
GCACTGAAGTTGAGATCCTAGAGAAGTCTCAAATTGAAGCCATTGCTTCCTCGTTAGCCTCACAGAATGAGGTTCCTGCG
GCACCCCTGGAAGAACTGGCCTACAGACGGTCGCTTCGCGTGGCTCTGGACGTTCTGAGCGAGGGCTCGATTTGGAGTCA
AGAAAGCTCTGCAGGGACAGGTAGAGCTGACCGGTCTCTGCGAGGGAAGCCCATGGAGCATGTCTCCTCGCCCTGTGATT
CGAACTCCTCATCTCTTCCCCGCGGAGACGTGTTGGGCAGTTCCAGACCTCACAGGAGGAGGCCATGTGTGCAACAAAGC
CTGTCAAGTTCGTTCACTTGTGAAAAGGACCCCGAGTGCAAAGTGGACCACAAGAAGGGGCTCAGGAAAAGTGAAAACCC
AAGAGGCCCGTTGGTCCTCCCAGCTGGAGGTGGTGCCCAAGATGAGAGTGGGTCCAGAATCCACCACAAAAATTGGACTC
TTGCAAGTAAGAGGGGAGGAAACTCAGCGCAGAAGGCTAGCTTGTGCCTGAATGGATCTTCCCTTTCAGAGGACGACACG
GAGAGAGACATGGGGAGCAAAGGAGGCAGCTGGGCAGCCCCGTCCTTGCCCTCCGGGGTCAGGGAGGACGATCCCTGTGC
CAACGCTGAGGGACACGACCCCGGTCTGCCGTTGGGCAGCCTCACTGCGCCCCCAGCCCCTGAGCCCTCGGCCTGCTCAG
AGCCTGGAGAATGCCCTGCGAAAAAGAGGCCGCGCCTGGATGGCAGCCAAAGGCCGCCTGCCGTGCAGCTGGAGCCCATG
GCAGCAGGGGCCGCACCATCCCCCGGGCCGGGGCCAGGGCCCAGAGAGTCTGTGACCCCGCGCAGCACCGCCAGGCTGGG
CCCGCCTCCCTCCCACGCCTCTGCGGATGCAACCAGATGTCTTCCTTGCCCGGATTCCCAGAAGCTGGAGAAAGAGTGCC
AGTCTTCCGAAGAGTCCATGGGGTCTAATTCCATGCGTTCTATCCTGGAGGAAGACGAGGAAGACGAGGAGCCACCAAGA
GTCCTTTTATACCACGAACCACGTTCGTTTGAAGTAGGAATGCTAGTCTGGCATAAACATAAAAAATACCCCTTCTGGCC
AGCAGTGGTCAAAAGCGTCAGGCAGAGAGATAAGAAAGCAAGTGTGCTATACATCGAAGGACACATGAACCCGAAAATGA
AAGGTTTCACAGTGTCTCTTAAAAGTTTAAAGCACTTTGATTGTAAAGAGAAACAGACGCTTCTGAATCAAGCCAGGGAG
GACTTCAACCAGGACATCGGCTGGTGTGTCTCCCTCATCACCGACTACAGGGTCCGGTTAGGCTGCGGGTCTTTTGCTGG
CTCTTTCCTGGAATATTACGCGGCTGATATAAGCTATCCTGTCCGAAAATCCATCCAGCAGGACGTCTTGGGGACCAAGC
TTCCTCAACTGAGCAAGGGGAGCCCCGAGGAGCCCGTGGTGGGGTGCCCCCTGGGGCAGAGGCAGCCCTGCCGGAAAATG
CTCCCCGACCGCTCGCGGGCCGCCCGGGACCGGGCCAACCAGAAGCTGGTGGAGTACATTGTGAAGGCCAAGGGCGCGGA
GAGCCACCTGCGGGCCATCCTAAAGAGCAGGAAGCCATCTCGCTGGCTGCAGACCTTCCTGAGCTCCAGCCAGTACGTGA
CCTGTGTGGAGACCTACCTGGAGGATGAGGGGCAGCTGGACCTGGTGGTGAAGTACCTGCAGGGCGTCTACCAGGAGGTG
GGGGCCAAGGTGCTCCAGCGCACCAACGGCGACCGGATCCGGTTCATTCTGGACGTGCTTCTGCCCGAGGCCATCATCTG
TGCGATCTCTGCGGTGGACGAGGTGGACTACAAGACGGCTGAGGAGAAGTACATCAAGGGGCCTTCGCTGAGCTACCGGG
AAAAAGAAATATTTGACAACCAGCTCCTTGAAGAGCGGAACCGGCGCCGTCGGTAG

Protein (711aa)

>JHU11761
MMADAKYVLCRWEKRLWPAKVLARTATSTKNKRRKEYFLAVQILSLEEKIKVKSTEVEILEKSQIEAIASSLASQNEVPA
APLEELAYRRSLRVALDVLSEGSIWSQESSAGTGRADRSLRGKPMEHVSSPCDSNSSSLPRGDVLGSSRPHRRRPCVQQS
LSSSFTCEKDPECKVDHKKGLRKSENPRGPLVLPAGGGAQDESGSRIHHKNWTLASKRGGNSAQKASLCLNGSSLSEDDT
ERDMGSKGGSWAAPSLPSGVREDDPCANAEGHDPGLPLGSLTAPPAPEPSACSEPGECPAKKRPRLDGSQRPPAVQLEPM
AAGAAPSPGPGPGPRESVTPRSTARLGPPPSHASADATRCLPCPDSQKLEKECQSSEESMGSNSMRSILEEDEEDEEPPR
VLLYHEPRSFEVGMLVWHKHKKYPFWPAVVKSVRQRDKKASVLYIEGHMNPKMKGFTVSLKSLKHFDCKEKQTLLNQARE
DFNQDIGWCVSLITDYRVRLGCGSFAGSFLEYYAADISYPVRKSIQQDVLGTKLPQLSKGSPEEPVVGCPLGQRQPCRKM
LPDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPSRWLQTFLSSSQYVTCVETYLEDEGQLDLVVKYLQGVYQEV
GAKVLQRTNGDRIRFILDVLLPEAIICAISAVDEVDYKTAEEKYIKGPSLSYREKEIFDNQLLEERNRRRR