Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11760 BC126936_frag Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
35 16 15 JHU11760
35 16 16 JHU11760
HuProt v3.0
Block Row Column Clone
13 5 4 JHU11760
13 6 4 JHU11760
HuProt v3.1
Block Row Column Clone
13 5 4 JHU11760
13 6 4 JHU11760

Nucleotide (183bp)

>JHU11760
ATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTATTGAAGATGACCTTAGAAGAGAGACG
CAAAGAATACCTAAGAGACTATATTCCCCTGAACAGCATTCTATCATGGAAGGAGGAGATGAAGGGCAAGGGCCAAAATG
ATGGATGCATCTCTCATGGTTAG

Protein (60aa)

>JHU11760
MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDGCISHG