Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11751 KIF3C Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
19 16 5 JHU11751
19 16 6 JHU11751
HuProt v3.0
Block Row Column Clone
15 1 4 JHU11751
15 2 4 JHU11751
HuProt v3.1
Block Row Column Clone
15 1 4 JHU11751
15 2 4 JHU11751

External Database ID

Nucleotide (2382bp)

>JHU11751
ATGGCCAGTAAGACCAAGGCCAGCGAGGCCCTCAAGGTGGTGGCCCGGTGCCGCCCCCTCAGCAGGAAGGAGGAGGCTGC
TGGTCACGAGCAGATCCTGACCATGGACGTGAAACTGGGCCAGGTGACCCTGCGGAACCCCCGCGCCGCCCCGGGGGAGC
TGCCCAAGACCTTCACCTTTGACGCCGTGTATGATGCCAGCTCCAAGCAGGCCGACCTGTATGACGAAACCGTGAGGCCC
CTGATAGACTCCGTGCTCCAGGGTTTCAATGGCACGGTGTTTGCCTATGGCCAGACGGGCACTGGCAAGACCTATACCAT
GCAGGGGACCTGGGTGGAGCCCGAGCTGCGCGGGGTCATCCCGAATGCCTTTGAGCACATCTTCACCCACATCTCCCGCT
CCCAGAACCAACAGTACCTGGTCCGGGCCTCCTATTTGGAGATCTACCAGGAAGAGATTCGAGACCTGCTCTCCAAGGAG
CCGGGCAAGAGGCTAGAGCTGAAAGAGAACCCCGAGACTGGCGTCTACATCAAGGACCTCTCCTCCTTCGTCACCAAGAA
TGTCAAGGAGATTGAGCATGTGATGAACCTGGGGAACCAGACCCGGGCTGTGGGCAGCACCCACATGAATGAGGTCAGCT
CCCGCTCCCATGCCATCTTCATCATCACTGTGGAGTGCAGCGAACGTGGCTCTGATGGCCAGGACCACATCCGAGTGGGC
AAGCTCAACCTCGTGGACCTGGCTGGCAGCGAGAGGCAGAACAAGGCAGGCCCCAACACAGCGGGAGGGGCAGCCACACC
ATCCTCGGGTGGCGGTGGTGGCGGTGGAGGCAGTGGTGGTGGTGCTGGTGGAGAGAGGCCTAAGGAAGCCTCCAAAATCA
ACCTCTCATTATCTGCCCTGGGCAACGTGATTGCTGCCCTGGCGGGCAACAGGAGCACCCACATTCCCTACCGGGACTCC
AAGCTGACCCGGCTGCTCCAGGACTCCCTGGGGGGGAATGCCAAGACCATCATGGTAGCCACACTGGGGCCAGCTTCTCA
CAGCTACGATGAGAGCCTCTCCACCTTGCGCTTTGCCAACCGAGCCAAGAACATCAAGAACAAGCCCCGGGTGAACGAGG
ACCCCAAGGACACACTGCTGCGGGAATTCCAAGAGGAGATTGCCCGCCTGAAGGCCCAGCTGGAGAAGAGGGGGATGCTG
GGGAAGCGGCCCCGGAGGAAGAGCAGCCGCAGGAAGAAGGCCGTGTCCGCCCCGCCTGGGTACCCTGAGGGCCCAGTGAT
TGAGGCCTGGGTGGCAGAAGAGGAGGATGACAACAACAACAACCACCGCCCGCCCCAGCCCATCCTGGAGTCAGCCTTGG
AGAAGAACATGGAGAATTACCTGCAGGAACAGAAGGAGCGGCTGGAGGAGGAGAAGGCAGCCATCCAGGATGACCGCAGC
CTGGTGAGCGAGGAGAAGCAGAAGCTGCTGGAGGAGAAGGAGAAGATGCTGGAGGACCTGCGGCGGGAACAGCAGGCCAC
AGAGCTGCTTGCGGCCAAGTACAAGGCCATGGAGAGCAAGCTCCTCATCGGGGGCAGGAACATCATGGATCACACCAACG
AACAGCAGAAGATGTTGGAACTGAAGAGGCAGGAGATTGCCGAGCAGAAACGTCGTGAGCGGGAGATGCAGCAGGAGATG
ATGCTCCGGGACGAGGAGACTATGGAGCTCCGGGGCACCTACACATCCCTGCAGCAGGAGGTGGAGGTCAAAACCAAGAA
ACTCAAGAAGCTCTACGCCAAGCTGCAGGCGGTGAAGGCGGAGATCCAGGACCAGCATGATGAGTATATCCGCGTGCGGC
AGGACCTGGAGGAGGCGCAGAACGAGCAGACCCGCGAACTCAAGCTCAAGTACCTAATCATCGAGAACTTCATCCCGCCG
GAGGAGAAGAACAAGATCATGAACCGGCTTTTCCTGGACTGTGAGGAGGAGCAGTGGAAGTTCCAGCCACTGGTGCCAGC
CGGCGTCAGTAGCAGCCAGATGAAGAAGCGGCCAACATCTGCAGTGGGCTACAAGAGGCCTATCAGCCAGTATGCTCGGG
TTGCCATGGCAATGGGGTCCCACCCCAGGTACAGGGCTGAAAACATAATGTTTCTGGAGTTGGATGTGTCCCCTCCAGCT
GTCTTTGAGATGGAATTCTCTCACGACCAAGAACAAGACCCTCGTGCGCTACACATGGAGAGGCTCATGCGATTGGACAG
CTTTCTGGAAAGACCTTCCACGTCTAAAGTCCGAAAGTCCAGATCCTGGTGCCAGAGTCCTCAGCGGCCTCCACCTTCCA
CCACACATGCCTCCCTGGCCTCTGCTTCTCTGCGCCCTGCAACAGTGGCGGACCATGAGTAG

Protein (793aa)

>JHU11751
MASKTKASEALKVVARCRPLSRKEEAAGHEQILTMDVKLGQVTLRNPRAAPGELPKTFTFDAVYDASSKQADLYDETVRP
LIDSVLQGFNGTVFAYGQTGTGKTYTMQGTWVEPELRGVIPNAFEHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKE
PGKRLELKENPETGVYIKDLSSFVTKNVKEIEHVMNLGNQTRAVGSTHMNEVSSRSHAIFIITVECSERGSDGQDHIRVG
KLNLVDLAGSERQNKAGPNTAGGAATPSSGGGGGGGGSGGGAGGERPKEASKINLSLSALGNVIAALAGNRSTHIPYRDS
KLTRLLQDSLGGNAKTIMVATLGPASHSYDESLSTLRFANRAKNIKNKPRVNEDPKDTLLREFQEEIARLKAQLEKRGML
GKRPRRKSSRRKKAVSAPPGYPEGPVIEAWVAEEEDDNNNNHRPPQPILESALEKNMENYLQEQKERLEEEKAAIQDDRS
LVSEEKQKLLEEKEKMLEDLRREQQATELLAAKYKAMESKLLIGGRNIMDHTNEQQKMLELKRQEIAEQKRREREMQQEM
MLRDEETMELRGTYTSLQQEVEVKTKKLKKLYAKLQAVKAEIQDQHDEYIRVRQDLEEAQNEQTRELKLKYLIIENFIPP
EEKNKIMNRLFLDCEEEQWKFQPLVPAGVSSSQMKKRPTSAVGYKRPISQYARVAMAMGSHPRYRAENIMFLELDVSPPA
VFEMEFSHDQEQDPRALHMERLMRLDSFLERPSTSKVRKSRSWCQSPQRPPPSTTHASLASASLRPATVADHE