Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11740 ELF2 NERF Homo sapiens Yes Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
41 16 15 JHU11740
41 16 16 JHU11740
HuProt v3.0
Block Row Column Clone
13 5 25 JHU11740
13 6 25 JHU11740
HuProt v3.1
Block Row Column Clone
13 5 25 JHU11740
13 6 25 JHU11740

External Database ID

Nucleotide (1746bp)

>JHU11740
ATGACATCAGCAGTGGTTGACAGTGGAGGTACTATTTTGGAGCTTTCCAGCAATGGAGTAGAAAATCAAGAGGAAAGTGA
AAAGGTTTCTGAATATCCAGCAGTGATTGTGGAGCCAGTTCCAAGTGCCAGATTAGAGCAGGGCTATGCAGCCCAGGTTC
TGGTTTATGATGATGAGACTTATATGATGCAAGATGTGGCAGAAGAACAAGAAGTTGAGACCGAGAATGTGGAAACAGTG
GAAGCATCAGTTCACAGCAGTAATGCACACTGTACAGATAAGACAATTGAAGCTGCTGAAGCCCTGCTTCATATGGAATC
TCCTACCTGCTTGAGGGATTCAAGAAGTCCTGAATTCATCCATGCTGCTATGAGGCCAGATGTCATTACAGAAACTGTAG
TGGAGGTGTCAACTGAAGAGTCTGAACCCATGGATACCTCTCCTATTCCAACATCACCAGATAGCCATGAACCAATGAAA
AAGAAAAAAGTTGGCCGTAAACCAAAGACCCAGCAATCACCAATTTCCAATGGGTCTCCTGAGTTAGGTATAAAGAAGAA
ACCAAGAGAAGGAAAAGGAAACACAACCTATTTGTGGGAGTTTCTTTTAGATCTACTTCAAGATAAAAATACTTGTCCCA
GGTATATTAAATGGACTCAGAGAGAAAAAGGCATATTCAAGCTGGTGGATTCAAAGGCTGTCTCTAAGCTTTGGGGAAAG
CATAAGAACAAACCAGACATGAACTATGAAACCATGGGACGAGCTTTGAGATACTACTACCAAAGGGGAATTCTTGCAAA
GGTTGAAGGACAGAGGCTTGTATATCAGTTCAAGGATATGCCGAAAAACATAGTGGTCATAGATGATGACAAAAGTGAAA
CCTGTAATGAAGATTTAGCAGGAACTACTGATGAAAAATCATTAGAACGAGTGTCACTGTCTGCAGAAAGTCTCCTGAAA
GCAGCATCCTCTGTTCGCAGTGGAAAAAATTCATCCCCTATAAACTGCTCCAGAGCAGAGAAGGGTGTAGCTAGAGTTGT
GAATATCACTTCCCCTGGGCACGATGCTTCATCCAGGTCTCCTACTACCACTGCATCTGTGTCAGCAACAGCAGCTCCAA
GGACAGTTCGTGTGGCAATGCAGGTACCTGTTGTAATGACATCATTGGGTCAGAAAATTTCAACTGTGGCAGTTCAGTCA
GTTAATGCAGGTGCACCATTAATAACCAGCACTAGTCCAACAACAGCGACCTCTCCAAAGGTAGTCATTCAGACAATCCC
TACTGTGATGCCAGCTTCTACTGAAAATGGAGACAAAATCACCATGCAGCCTGCCAAAATTATTACCATCCCAGCTACAC
AGCTTGCACAGTGTCAACTGCAGACAAAGTCAAATCTGACTGGATCAGGAAGCATTAACATTGTTGGAACCCCATTGGCT
GTGAGAGCACTTACCCCTGTTTCAATAGCCCATGGTACACCTGTAATGAGACTATCAATGCCTACTCAGCAGGCATCTGG
CCAGACTCCTCCTCGAGTTATCAGTGCAGTCATAAAGGGGCCAGAGGTTAAATCGGAAGCAGTGGCAAAAAAGCAAGAAC
ATGATGTGAAAACTTTGCAGCTAGTAGAAGAAAAACCAGCAGATGGAAATAAGACAGTGACCCACGTAGTGGTTGTCAGT
GCGCCTTCAGCTATTGCCCTTCCTGTAACTATGAAAACAGAAGGACTAGTGACATGTGAGAAATAG

Protein (581aa)

>JHU11740
MTSAVVDSGGTILELSSNGVENQEESEKVSEYPAVIVEPVPSARLEQGYAAQVLVYDDETYMMQDVAEEQEVETENVETV
EASVHSSNAHCTDKTIEAAEALLHMESPTCLRDSRSPEFIHAAMRPDVITETVVEVSTEESEPMDTSPIPTSPDSHEPMK
KKKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGK
HKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKDMPKNIVVIDDDKSETCNEDLAGTTDEKSLERVSLSAESLLK
AASSVRSGKNSSPINCSRAEKGVARVVNITSPGHDASSRSPTTTASVSATAAPRTVRVAMQVPVVMTSLGQKISTVAVQS
VNAGAPLITSTSPTTATSPKVVIQTIPTVMPASTENGDKITMQPAKIITIPATQLAQCQLQTKSNLTGSGSINIVGTPLA
VRALTPVSIAHGTPVMRLSMPTQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPADGNKTVTHVVVVS
APSAIALPVTMKTEGLVTCEK