Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11737 GRAMD4 DIP;KIAA0767 Homo sapiens Yes Cell Death

HuProt v2.0
Block Row Column Clone
27 16 15 JHU11737
27 16 16 JHU11737
HuProt v3.0
Block Row Column Clone
13 5 16 JHU11737
13 6 16 JHU11737
HuProt v3.1
Block Row Column Clone
13 5 16 JHU11737
13 6 16 JHU11737

External Database ID

Nucleotide (1737bp)

>JHU11737
ATGCTAAGGAGGTTGGACAAAATCAGGTTCAGAGGTCACAAGAGAGATGACTTCCTCGATCTAGCGGAGTCTCCAAATGC
CTCGGACACCGAATGCAGCGACGAAATCCCCCTGAAGGTACCGCGGACCTCGCCCCGGGACAGCGAGGAGCTGAGGGACC
CTGCTGGTCCAGGGACCCTCATCATGGCCACAGGAGTCCAGGACTTTAACCGGACAGAGTTTGATCGACTGAATGAGATC
AAAGGTCACCTGGAAATTGCCTTATTGGAAAAACATTTCTTACAGGAGGAGCTCCGGAAGCTGCGAGAAGAAACCAACGC
GGAGATGCTGCGGCAGGAGCTGGACCGCGAGCGGCAGCGGCGGATGGAGCTGGAGCAGAAGGTGCAGGAGGTGCTGAAGG
CCAGAACCGAGGAGCAGATGGCTCAGCAGCCCCCAAAAGGGCAGGCCCAGGCCAGCAATGGAGCAGAGCGCCGGAGCCAG
GGGCTGTCCTCGCGCCTGCAGAAGTGGTTCTACGAGCGGTTCGGGGAGTACGTGGAGGACTTCCGGTTCCAGCCCGAGGA
GAACACTGTGGAGACAGAGGAACCCCTGAGCGCCCGCAGGTTAACTGAAAATATGAGACGGCTCAAGCGCGGTGCCAAGC
CGGTCACTAACTTTGTGAAGAACCTCTCTGCCTTATCCGACTGGTACTCCGTCTACACGTCTGCCATTGCCTTCACCGTG
TACATGAATGCCGTGTGGCATGGCTGGGCCATCCCATTGTTCTTATTTCTAGCAATTCTGAGGTTATCCCTCAATTACCT
CATCGCCAGGGGGTGGCGGATACAGTGGAGCATCGTGCCCGAAGTGTCTGAGCCCGTGGAACCTCCAAAGGAAGACCTGA
CTGTGTCTGAGAAGTTCCAGCTGGTGCTGGACGTCGCCCAGAAAGCCCAGAACCTTTTCGGGAAGATGGCTGACATCCTG
GAGAAGATCAAGAACTTGTTCATGTGGGTCCAGCCGGAGATCACACAGAAGCTGTATGTGGCGCTCTGGGCTGCCTTCCT
GGCCTCCTGCTTCTTCCCCTACCGCCTGGTGGGGCTTGCCGTGGGACTCTATGCTGGTATCAAGTTCTTCCTCATTGATT
TCATCTTTAAACGCTGCCCGAGGCTGCGCGCCAAGTACGACACGCCCTATATCATCTGGAGGAGTCTCCCCACCGACCCG
CAGCTCAAGGAGCGCTCCAGCGCCGCAGTCTCACGCAGGCTGCAGACGACCTCGTCACGGAGCTACGTACCCAGCGCACC
GGCCGGCCTGGGTAAAGAGGAGGACGCCGGTCGCTTCCACAGCACCAAGAAGGGCAATTTCCACGAGATCTTCAATCTGA
CAGAAAACGAGCGTCCGCTGGCGGTGTGCGAGAATGGCTGGCGCTGCTGCCTCATCAACAGGGACCGGAAGATGCCCACG
GACTACATCAGGAACGGGGTGCTCTACGTCACGGAGAATTACTTGTGCTTCGAAAGCTCCAAATCTGGGTCCTCAAAGAG
GAACAAAGTCATCAAGCTAGTGGACATCACGGACATCCAGAAGTACAAGGTCCTGTCTGTCCTCCCAGGCTCAGGCATGG
GGATTGCCGTGTCGACGCCATCCACCCAGAAACCGCTCGTGTTTGGTGCCATGGTGCACAGGGATGAGGCCTTCGAGACC
ATTCTCAGCCAGTACATCAAGATCACCTCAGCGGCAGCGTCTGGCGGGGACAGCTAG

Protein (578aa)

>JHU11737
MLRRLDKIRFRGHKRDDFLDLAESPNASDTECSDEIPLKVPRTSPRDSEELRDPAGPGTLIMATGVQDFNRTEFDRLNEI
KGHLEIALLEKHFLQEELRKLREETNAEMLRQELDRERQRRMELEQKVQEVLKARTEEQMAQQPPKGQAQASNGAERRSQ
GLSSRLQKWFYERFGEYVEDFRFQPEENTVETEEPLSARRLTENMRRLKRGAKPVTNFVKNLSALSDWYSVYTSAIAFTV
YMNAVWHGWAIPLFLFLAILRLSLNYLIARGWRIQWSIVPEVSEPVEPPKEDLTVSEKFQLVLDVAQKAQNLFGKMADIL
EKIKNLFMWVQPEITQKLYVALWAAFLASCFFPYRLVGLAVGLYAGIKFFLIDFIFKRCPRLRAKYDTPYIIWRSLPTDP
QLKERSSAAVSRRLQTTSSRSYVPSAPAGLGKEEDAGRFHSTKKGNFHEIFNLTENERPLAVCENGWRCCLINRDRKMPT
DYIRNGVLYVTENYLCFESSKSGSSKRNKVIKLVDITDIQKYKVLSVLPGSGMGIAVSTPSTQKPLVFGAMVHRDEAFET
ILSQYIKITSAAASGGDS