Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11719 AVPR1A AVPR1 Homo sapiens Yes Kinases; Membrane Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
27 16 9 JHU11719
27 16 10 JHU11719
HuProt v3.0
Block Row Column Clone
14 1 24 JHU11719
14 2 24 JHU11719
HuProt v3.1
Block Row Column Clone
14 1 24 JHU11719
14 2 24 JHU11719

External Database ID

Nucleotide (1257bp)

>JHU11719
ATGCGTCTCTCCGCCGGTCCCGACGCGGGGCCCTCGGGCAACTCCAGCCCATGGTGGCCTCTGGCCACCGGCGCTGGCAA
CACAAGCCGGGAGGCCGAAGCCCTCGGGGAGGGCAACGGCCCACCGAGGGACGTGCGCAACGAGGAGCTGGCCAAACTGG
AGATCGCCGTGCTGGCGGTGACTTTCGCGGTGGCCGTGCTGGGCAACAGCAGCGTACTGCTGGCTCTGCACCGGACGCCG
CGCAAGACGTCCCGCATGCACCTCTTCATCCGACACCTCAGCCTGGCCGACCTGGCCGTGGCATTCTTCCAGGTGCTGCC
GCAAATGTGCTGGGACATCACCTACCGCTTCCGCGGCCCCGACTGGCTGTGTCGCGTGGTGAAGCACCTGCAGGTGTTCG
GCATGTTCGCGTCGGCCTACATGCTGGTAGTCATGACAGCCGACCGCTACATCGCGGTGTGCCACCCGCTCAAGACTCTG
CAACAGCCCGCGCGCCGCTCGCGCCTCATGATCGCGGCCGCCTGGGTGCTGAGCTTCGTGCTGAGCACGCCGCAGTACTT
CGTCTTCTCCATGATCGAGGTGAACAATGTCACCAAGGCCCGCGACTGCTGGGCCACCTTCATCCAGCCCTGGGGTTCTC
GTGCCTACGTGACCTGGATGACGGGCGGCATCTTTGTGGCGCCCGTGGTCATCTTGGGTACCTGCTACGGCTTCATCTGC
TACAACATCTGGTGCAACGTCCGCGGGAAGACGGCGTCGCGCCAGAGCAAGGGTGCAGAGCAAGCGGGTGTGGCCTTCCA
AAAGGGGTTCCTGCTCGCACCCTGTGTCAGCAGCGTGAAGTCCATTTCCCGGGCCAAGATCCGCACGGTGAAGATGACTT
TTGTGATCGTGACGGCTTACATCGTCTGCTGGGCGCCTTTCTTCATCATCCAGATGTGGTCTGTCTGGGATCCCATGTCC
GTCTGGACCGAATCGGAAAACCCTACCATCACCATCACTGCATTACTGGGTTCCTTGAATAGCTGCTGTAATCCCTGGAT
ATACATGTTTTTTAGTGGCCATCTCCTTCAAGACTGTGTTCAAAGCTTCCCATGCTGCCAAAACATGAAGGAAAAATTCA
ACAAAGAAGATACTGACAGTATGAGCAGAAGACAGACTTTTTATTCTAACAATCGAAGCCCAACAAACAGTACGGGTATG
TGGAAGGACTCGCCTAAATCTTCCAAGTCCATCAAATTCATTCCTGTTTCAACTTAG

Protein (418aa)

>JHU11719
MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAVTFAVAVLGNSSVLLALHRTP
RKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGPDWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTL
QQPARRSRLMIAAAWVLSFVLSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAYIVCWAPFFIIQMWSVWDPMS
VWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGM
WKDSPKSSKSIKFIPVST