Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11695 UBA3 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
6 16 13 JHU11695
6 16 14 JHU11695
HuProt v3.0
Block Row Column Clone
13 1 9 JHU11695
13 2 9 JHU11695
HuProt v3.1
Block Row Column Clone
13 1 9 JHU11695
13 2 9 JHU11695

External Database ID

Nucleotide (1092bp)

>JHU11695
ATGGACACTATAGATGTTTCCAATCTAAATAGGCAGTTTTTATTTAGGCCTAAAGATATTGGAAGACCTAAGGCTGAAGT
TGCTGCAGAATTTCTAAATGACAGAGTTCCTAATTGCAATGTAGTTCCACATTTCAACAAGATTCAAGATTTTAACGACA
CTTTCTATCGACAATTTCATATTATTGTATGTGGACTGGACTCTATCATCGCCAGAAGATGGATAAATGGCATGCTGATA
TCTCTTCTAAATTATGAAGATGGTGTCTTAGATCCAAGCTCCATTGTCCCTTTGATAGATGGGGGGACAGAAGGTTTTAA
AGGAAATGCCCGGGTGATTCTGCCTGGAATGACTGCTTGTATCGAATGCACGCTGGAACTTTATCCACCACAGGTTAATT
TTCCCATGTGCACCATTGCATCTATGCCCAGGCTACCAGAACACTGTATTGAGTATGTAAGGATGTTGCAGTGGCCTAAG
GAGCAGCCTTTTGGAGAAGGGGTTCCATTAGATGGAGATGATCCTGAACATATACAATGGATTTTCCAAAAATCCCTAGA
GAGAGCATCACAATATAATATTAGGGGTGTTACGTATAGGCTCACTCAAGGGGTAGTAAAAAGAATCATTCCTGCAGTAG
CTTCCACAAATGCAGTCATTGCAGCTGTGTGTGCCACTGAGGTTTTTAAAATAGCCACAAGTGCATACATTCCCTTGAAT
AATTACTTGGTGTTTAATGATGTAGATGGGCTGTATACATACACATTTGAAGCAGAAAGAAAGGAAAACTGCCCAGCTTG
TAGCCAGCTTCCTCAAAATATTCAGTTTTCTCCATCAGCTAAACTACAGGAGGTTTTGGATTATCTAACCAATAGTGCTT
CTCTGCAAATGAAATCTCCAGCCATCACAGCCACCCTAGAGGGAAAAAATAGAACACTTTACTTACAGTCGGTAACCTCT
ATTGAAGAACGAACAAGGCCAAATCTCTCCAAAACATTGAAAGAATTGGGGCTTGTTGATGGACAAGAACTGGCGGTTGC
TGATGTCACCACCCCACAGACTGTACTATTCAAACTTCATTTTACTTCTTAG

Protein (363aa)

>JHU11695
MDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLI
SLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPK
EQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLN
NYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTS
IEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS