Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11693 TCEA2 Homo sapiens Yes Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
8 16 1 JHU11693
8 16 2 JHU11693
HuProt v3.0
Block Row Column Clone
16 1 8 JHU11693
16 2 8 JHU11693
HuProt v3.1
Block Row Column Clone
16 1 8 JHU11693
16 2 8 JHU11693

External Database ID

Nucleotide (819bp)

>JHU11693
ATGGATTTGCTGCGGGAGCTGAAGGCCATGCCTATCACGCTGCACCTGCTCCAGTCCACCCGAGTCGGGATGTCTGTCAA
CGCCCTTCGGAAGCAGAGCTCGGATGAGGAGGTCATTGCACTGGCCAAGTCTCTCATCAAGTCCTGGAAGAAGCTCCTGG
ATGCTTCCGATGCCAAAGCCAGGGAGCGGGGGAGGGGCATGCCTCTGCCCACGTCCTCGAGGGATGCCTCAGAGGCCCCG
GATCCCAGCCGCAAGAGGCCGGAGCTGCCCAGGGCACCGTCGACTCCGAGGATCACCACATTTCCTCCGGTGCCTGTCAC
CTGTGATGCCGTGCGCAACAAGTGCCGCGAGATGCTGACCGCTGCCCTGCAGACGGACCATGACCACGTGGCCATCGGTG
CGGACTGCGAGCGCCTGTCGGCTCAGATCGAGGAATGCATCTTCCGGGACGTTGGAAACACAGACATGAAGTATAAGAAC
CGTGTACGGAGTCGTATCTCCAACCTGAAGGATGCCAAGAACCCTGACCTGCGGCGGAATGTGCTGTGTGGGGCCATAAC
ACCCCAGCAGATCGCTGTGATGACCTCAGAGGAGATGGCCAGTGATGAGCTGAAGGAGATCCGTAAGGCCATGACCAAGG
AGGCCATCCGAGAGCACCAGATGGCCCGCACTGGCGGCACGCAGACAGACCTGTTCACCTGCGGCAAGTGCAGGAAAAAG
AACTGCACCTACACACAGGTGCAGACCCGCAGCTCTGATGAGCCCATGACCACCTTTGTTGTCTGCAACGAGTGTGGAAA
CCGCTGGAAGTTCTGCTAG

Protein (272aa)

>JHU11693
MDLLRELKAMPITLHLLQSTRVGMSVNALRKQSSDEEVIALAKSLIKSWKKLLDASDAKARERGRGMPLPTSSRDASEAP
DPSRKRPELPRAPSTPRITTFPPVPVTCDAVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKN
RVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEMASDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCGKCRKK
NCTYTQVQTRSSDEPMTTFVVCNECGNRWKFC