Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11686 SH3BGR Homo sapiens Yes Signal Transduction

HuProt v2.0
Block Row Column Clone
30 16 5 JHU11686
30 16 6 JHU11686
HuProt v3.0
Block Row Column Clone
15 1 27 JHU11686
15 2 27 JHU11686
HuProt v3.1
Block Row Column Clone
15 1 27 JHU11686
15 2 27 JHU11686

External Database ID

Nucleotide (387bp)

>JHU11686
ATGAGAGAGAATGTTCCTGGAGAGAAAAAACCTCAAAATGGGATTCCTTTGCCTCCCCAGATCTTCAATGAGGAGCAGTA
CTGTGGGGATTTTGACTCTTTCTTCTCTGCAAAAGAAGAGAATATTATTTATTCCTTCCTTGGTTTGGCTCCTCCTCCAG
ACTCAAAGGGATCAGAGAAGGCTGAAGAAGGTGGAGAAACTGAGGCACAAAAAGAGGGCAGTGAAGATGTGGGCAACCTC
CCTGAAGCCCAGGAGAAGAATGAAGAAGAAGGAGAGACAGCCACAGAAGAGACGGAAGAAATAGCCATGGAGGGTGCGGA
AGGGGAAGCCGAGGAGGAGGAAGAAACTGCAGAAGGAGAAGAGCCTGGAGAAGACGAAGATTCCTAG

Protein (128aa)

>JHU11686
MRENVPGEKKPQNGIPLPPQIFNEEQYCGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDVGNL
PEAQEKNEEEGETATEETEEIAMEGAEGEAEEEEETAEGEEPGEDEDS