Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU11684 SCIN KIAA1905 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
14 16 5 JHU11684
14 16 6 JHU11684
HuProt v3.0
Block Row Column Clone
15 1 29 JHU11684
15 2 29 JHU11684
HuProt v3.1
Block Row Column Clone
15 1 29 JHU11684
15 2 29 JHU11684

External Database ID

Nucleotide (1407bp)

>JHU11684
ATGGCTAAACTATACATGGTTTCAGATGCAAGTGGCTCCATGAGAGTGACTGTGGTGGCAGAAGAAAACCCCTTCTCAAT
GGCAATGCTGCTGTCTGAAGAATGCTTTATTTTGGACCACGGGGCTGCCAAACAAATTTTCGTATGGAAAGGTAAAGATG
CTAATCCCCAAGAGAGGAAGGCTGCAATGAAGACAGCTGAAGAATTTCTACAGCAAATGAATTATTCCAAGAATACCCAA
ATTCAAGTTCTTCCAGAAGGAGGTGAAACACCAATCTTCAAACAGTTTTTTAAGGACTGGAGAGATAAAGATCAGAGTGA
TGGCTTCGGGAAAGTTTATGTCACAGAGAAAGTGGCTCAAATAAAACAAATTCCCTTTGATGCCTCAAAATTACACAGTT
CTCCGCAGATGGCAGCCCAGCACAATATGGTGGATGATGGTTCTGGCAAAGTGGAGATTTGGCGTGTAGAAAACAATGGT
AGGATCCAAGTTGACCAAAACTCATATGGTGAATTCTATGGTGGTGACTGCTACATCATACTCTACACCTATCCCAGAGG
ACAGATTATCTACACGTGGCAAGGAGCAAATGCCACACGAGATGAGCTGACAACATCTGCGTTCCTGACTGTTCAGTTGG
ATCGGTCCCTTGGAGGACAGGCTGTGCAGATCCGAGTCTCCCAAGGCAAAGAGCCTGTTCACCTACTGAGTTTGTTCAAA
GACAAACCGCTCATTATTTACAAGAATGGAACATCAAAGAAAGGAGGTCAGGCACCTGCTCCCCCTACACGCCTCTTTCA
AGTCCGGAGAAACCTGGCATCTATCACCAGAATTGTGGAGGTTGATGTTGATGCAAATTCACTGAATTCTAACGATGTTT
TTGTCCTGAAACTGCCACAAAATAGTGGCTACATCTGGGTAGGAAAAGGTGCTAGCCAGGAGGAGGAGAAAGGAGCAGAG
TATGTAGCAAGTGTCCTAAAGTGCAAAACCTTAAGGATCCAAGAAGGCGAGGAGCCAGAGGAGTTCTGGAATTCCCTTGG
AGGGAAAAAAGACTACCAGACCTCACCACTACTGGAAACCCAGGCTGAAGACCATCCACCTCGGCTTTACGGCTGCTCTA
ACAAAACTGGAAGATTTGTTATTGAAGAGATTCCAGGAGAGTTCACCCAGGATGATTTAGCTGAAGATGATGTCATGTTA
CTAGATGCTTGGGAACAGATATTTATTTGGATTGGCAAAGATGCTAATGAAGTTGAGAAAAAAGAATCTCTGAAGTCTGC
CAAAATGTACCTTGAGACAGACCCTTCTGGAAGAGACAAGAGGACACCAATTGTCATCATAAAACAGGGCCATGAGCCAC
CCACATTCACAGGCTGGTTCCTGGGCTGGGATTCCAGCAAGTGGTAG

Protein (468aa)

>JHU11684
MAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGAAKQIFVWKGKDANPQERKAAMKTAEEFLQQMNYSKNTQ
IQVLPEGGETPIFKQFFKDWRDKDQSDGFGKVYVTEKVAQIKQIPFDASKLHSSPQMAAQHNMVDDGSGKVEIWRVENNG
RIQVDQNSYGEFYGGDCYIILYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPVHLLSLFK
DKPLIIYKNGTSKKGGQAPAPPTRLFQVRRNLASITRIVEVDVDANSLNSNDVFVLKLPQNSGYIWVGKGASQEEEKGAE
YVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQTSPLLETQAEDHPPRLYGCSNKTGRFVIEEIPGEFTQDDLAEDDVML
LDAWEQIFIWIGKDANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQGHEPPTFTGWFLGWDSSKW